Recombinant Full Length Petunia Hybrida Bidirectional Sugar Transporter Nec1(Nec1) Protein, His-Tagged
Cat.No. : | RFL28642PF |
Product Overview : | Recombinant Full Length Petunia hybrida Bidirectional sugar transporter NEC1(NEC1) Protein (Q9FPN0) (1-265aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Petunia hybrida (Petunia) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-265) |
Form : | Lyophilized powder |
AA Sequence : | MAQLRADDLSFIFGLLGNIVSFMVFLAPVPTFYKIYKRKSSEGYQAIPYMVALFSAGLLL YYAYLRKNAYLIVSINGFGCAIELTYISLFLFYAPRKSKIFTGWLMLLELGALGMVMPIT YLLAEGSHRVMIVGWICAAINVAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWF FYGFFKKDFYIAFPNILGFLFGIVQMLLYFVYKDSKRIDDEKSDPVREATKSKEGVEIII NIEDDNSDNALQSMEKDFSRLRTSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NEC1 |
Synonyms | NEC1; Bidirectional sugar transporter NEC1; NEC1 |
UniProt ID | Q9FPN0 |
◆ Recombinant Proteins | ||
CASP3-507H | Recombinant Human CASP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GCG-1261H | Recombinant Human GCG Protein, MYC/DDK-tagged | +Inquiry |
PGM5-318H | Recombinant Human PGM5 Protein, His-tagged | +Inquiry |
GTPBP2-2015R | Recombinant Rhesus monkey GTPBP2 Protein, His-tagged | +Inquiry |
IL6R-051H | Active Recombinant Human IL6R protein, His/Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
ARPC2-01P | Native Porcine ARPC2 Protein (Arp2/3 Protein Complex) | +Inquiry |
Artery-015H | Human Artery Lysate, Total Protein | +Inquiry |
b-Glucosidase-10S | Active Native Sweet Almonds b-Glucosidase | +Inquiry |
Factor XIII-67H | Native Human Factor XIII | +Inquiry |
SHBG-5519H | Native Human Sex Hormone-Binding Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAMBPL1-1426HCL | Recombinant Human STAMBPL1 293 Cell Lysate | +Inquiry |
C17orf28-8240HCL | Recombinant Human C17orf28 293 Cell Lysate | +Inquiry |
MEF2C-4375HCL | Recombinant Human MEF2C 293 Cell Lysate | +Inquiry |
C14orf169-206HCL | Recombinant Human C14orf169 cell lysate | +Inquiry |
PAK2-1276HCL | Recombinant Human PAK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All NEC1 Products
Required fields are marked with *
My Review for All NEC1 Products
Required fields are marked with *
0
Inquiry Basket