Recombinant Full Length Perognathus Flavus Cytochrome C Oxidase Subunit 2(Mt-Co2) Protein, His-Tagged
Cat.No. : | RFL23978PF |
Product Overview : | Recombinant Full Length Perognathus flavus Cytochrome c oxidase subunit 2(MT-CO2) Protein (Q37595) (1-226aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Perognathus flavus (Silky pocket mouse) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-226) |
Form : | Lyophilized powder |
AA Sequence : | MAYPLQLGLQDATSPIMEELTSFHDHTLMIVFLISTLVLYIISLMLTTKLTHTSTMDAQE IETIWTILPAIILIMIALPSLRVLYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLSFDS YMVNTTDLKPGDLRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVSSSRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFEAWSASM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MT-CO2 |
Synonyms | MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II |
UniProt ID | Q37595 |
◆ Recombinant Proteins | ||
RPS3-6890H | Recombinant Human Ribosomal Protein S3, His-tagged | +Inquiry |
SCO1496-1356S | Recombinant Streptomyces coelicolor A3(2) SCO1496 protein, His-tagged | +Inquiry |
GABRR1-3437M | Recombinant Mouse GABRR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLA2G5-71H | Recombinant Human Phospholipase A2, Group V, His-tagged | +Inquiry |
EIF5A-1946HFL | Recombinant Full Length Human EIF5A Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1738S | Active Native Sambucus Nigra Lectin Protein, Fluorescein labeled | +Inquiry |
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
CKMB-256H | Active Native Human CKMB protein | +Inquiry |
VTN-31737TH | Native Human VTN | +Inquiry |
IgG-346D | Native Dog Gamma Globulin Fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM44-773HCL | Recombinant Human TRIM44 293 Cell Lysate | +Inquiry |
CDC42BPA-7654HCL | Recombinant Human CDC42BPA 293 Cell Lysate | +Inquiry |
MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
CPB-135R | Rabbit Anti-RSVgp07 Polyclonal Antibody | +Inquiry |
PSME3-2739HCL | Recombinant Human PSME3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MT-CO2 Products
Required fields are marked with *
My Review for All MT-CO2 Products
Required fields are marked with *
0
Inquiry Basket