Recombinant Full Length Peptidoglycan-Binding Protein Arfa(Arfa) Protein, His-Tagged
Cat.No. : | RFL29037MF |
Product Overview : | Recombinant Full Length Peptidoglycan-binding protein ArfA(arfA) Protein (P65594) (1-326aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-326) |
Form : | Lyophilized powder |
AA Sequence : | MASKAGLGQTPATTDARRTQKFYRGSPGRPWLIGAVVIPLLIAAIGYGAFERPQSVTGPT GVLPTLTPTSTRGASALSLSLLSISRSGNTVTLIGDFPDEAAKAALMTALNGLLAPGVNV IDQIHVDPVVRSLDFSSAEPVFTASVPIPDFGLKVERDTVTLTGTAPSSEHKDAVKRAAT STWPDMKIVNNIEVTGQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEIL NRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGL GSVNPIASNATPEGRAKNRRVEIVVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | arfA |
Synonyms | arfA; BQ2027_MB0923; Peptidoglycan-binding protein ArfA; Outer membrane protein ArfA |
UniProt ID | P65594 |
◆ Native Proteins | ||
HSV1-15 | Native Herpes Simplex Virus (HSV) Type 1 Antigen | +Inquiry |
Lectin-1825P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Fluorescein labeled | +Inquiry |
HBsAg-ad-21H | Native Human HBsAg protein (Subtype ad) | +Inquiry |
LOC100514666-45P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
C1S-550H | Active Native Human C1S Enzyme | +Inquiry |
◆ Cell & Tissue Lysates | ||
TDP2-664HCL | Recombinant Human TTRAP 293 Cell Lysate | +Inquiry |
EBNA1BP2-6734HCL | Recombinant Human EBNA1BP2 293 Cell Lysate | +Inquiry |
NUDT5-3643HCL | Recombinant Human NUDT5 293 Cell Lysate | +Inquiry |
IGJ-5259HCL | Recombinant Human IGJ 293 Cell Lysate | +Inquiry |
WFDC6-318HCL | Recombinant Human WFDC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All arfA Products
Required fields are marked with *
My Review for All arfA Products
Required fields are marked with *
0
Inquiry Basket