Recombinant Full Length Pelodictyon Luteolum Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL10758CF |
Product Overview : | Recombinant Full Length Pelodictyon luteolum ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (Q3B6R3) (1-706aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlorobium luteolum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-706) |
Form : | Lyophilized powder |
AA Sequence : | MAKNSLKPSNPYNSEPETPQPRPKLPMIYYVVVIALLIGLQLAFFWSGSSREIPYSTFRT FITENKVESVRIAPEKIYVTLKPGVDSGLPKQEEGNDTTRKLLPGAKTPENEVTVNPVRD ESLTALLETHGVRYEGSPGTTWISELIQWVLPFALLFGLYFFIFRRMGAGGPGAQFMNIG KNKAALYENLDEHTRITFKDVAGLDEAKAEVMEVVDFLKDPKKYTRLGGKLPKGVLLVGP PGTGKTLLAKAVAGEADVPFFSISGSDFVEMFVGVGAARVRDLFRQAKEKAPCIIFIDEI DAVGRSRGKGAMMGGNDERENTLNQLLVEMDGFATDKGVILMAATNRPDVLDPALLRPGR FDRQIMVDKPDLKGRMDTFRVHTKNMSLSPDVNLKALASQTPGFAGAEIANAANEAALLA SRRNKESIEMKDFEDAIERVVAGLEKKNKVINPKEKRIVAYHEAGHAIVSWMMPENDPVQ KISIVPRGMSALGYTMNIPLEDRYLMTKRELFARICGLLGGRIAEESVFGEISTGAQNDL EKITGIAYNMVMVYGMSDKIGNLSYYESNNPYYGAPGVEKKFGGETARLIDEEVKAIVES AADTVRTMLKEHRSKLEALARELLTKEMLQYCQIEEILGKRPGGQEEDSGEVDCSKKSAE NGMVAHEPETTADAESTEKVGLSATELAELEAAAERLRQSRNVSDN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; Plut_0078; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | Q3B6R3 |
◆ Recombinant Proteins | ||
JUN-3132H | Recombinant Human JUN Protein (Met1-Phe331), N-His tagged | +Inquiry |
ROBO1-594H | Recombinant Human ROBO1 | +Inquiry |
FBXO45-3169M | Recombinant Mouse FBXO45 Protein, His (Fc)-Avi-tagged | +Inquiry |
GJD2-2213R | Recombinant Rat GJD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUSD3-16258M | Recombinant Mouse SUSD3 Protein | +Inquiry |
◆ Native Proteins | ||
FABP-177R | Native Rabbit Fatty acid Binding Protein | +Inquiry |
Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
APOB-216H | Native Human APOB Protein | +Inquiry |
CALMODULIN-185B | Active Native Bovine Calmodulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PYCARD-2650HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
NPRL3-3730HCL | Recombinant Human NPRL3 293 Cell Lysate | +Inquiry |
SERPING1-2615HCL | Recombinant Human SERPING1 cell lysate | +Inquiry |
Pituitary-495C | Chicken Pituitary Lysate, Total Protein | +Inquiry |
PTN-1524MCL | Recombinant Mouse PTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket