Recombinant Full Length Paracoccus Denitrificans Macrolide Export Atp-Binding/Permease Protein Macb 3(Macb3) Protein, His-Tagged
Cat.No. : | RFL36859PF |
Product Overview : | Recombinant Full Length Paracoccus denitrificans Macrolide export ATP-binding/permease protein MacB 3(macB3) Protein (A1BCE9) (1-640aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Paracoccus Denitrificans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-640) |
Form : | Lyophilized powder |
AA Sequence : | MPLIRIRGLHRVFGEGAARAHVLRGIDLDIHAGEFVAIVGTSGSGKSTLMNILGLLDRPS AGSYHLAGKDVARLSRDARAGLRNRLFGFVFQQYNLIPTLTALENVELPASHAGAAREAR RARAAALLRSLGLGHRLTARPLQMSGGQQQRVSIARALMNGGAVILADEPTGALDAESGR QVMRLLSDLAGRGHTVILITHDTDIAARAGRVIRVGEGRIAGDSGTRAAGPAVPVLPETT GSRSAFLHALREAARSALAAIGASPVRTALTLSGIVIGVASVVAMLAIGRGAQEEFVKRA SAIGTNWVVVGSDQDTRMPRRPLTLDDAMALKGLPNVAGVMPGRWEQATVRAGAFSIDTD IIGTDRDFRGVHGWDVVRGSFFSEADERGGSPVLLLGSTVAGTLFPDGRDPTGEFVFVNM SPFLVGGVLESKGLSENGSDRDKVVAMPLRSLESRVYGPGELSVIVVALQDMARLDESNA LLREAMIRRHGTEDFWLADAAGAFAAAEADRASQNLLLGAVATISIFVGGIGVMNIMFIT VRERTREIGIRSATGAAMRDILVQFLTEATVLSALGGLAGLALAVGIGAVAALGLGMPVV FSVTVALGALAGATAMGAAFGLVPAIRAARLSPVEALASP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB3 |
Synonyms | macB3; Pden_5133; Macrolide export ATP-binding/permease protein MacB 3 |
UniProt ID | A1BCE9 |
◆ Recombinant Proteins | ||
HEXB-645H | Recombinant Human HEXB protein, His-tagged | +Inquiry |
DNASE1-2774H | Recombinant Human DNASE1 Protein, GST-tagged | +Inquiry |
RFL12345DF | Recombinant Full Length Danio Rerio 3-Hydroxyacyl-Coa Dehydratase(Ptplad1) Protein, His-Tagged | +Inquiry |
EPO-2525H | Recombinant Human EPO Protein (Val3-Arg193), N-His tagged | +Inquiry |
VAV3-2335H | Recombinant Human VAV3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CGB-1850H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
HBsAg-ad-21H | Native Human HBsAg protein (Subtype ad) | +Inquiry |
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
IgG Fc-07H | Native Human Immunoglobulin G Fc (IgG Fc) | +Inquiry |
Histone-52C | Native Calf Histone | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGF-001HCL | Recombinant Human NGF cell lysate | +Inquiry |
HCT 116-2146H | HCT 116 (human colorectal carcinoma) whole cell lysate | +Inquiry |
SPESP1-1520HCL | Recombinant Human SPESP1 293 Cell Lysate | +Inquiry |
HIST1H2BI-5538HCL | Recombinant Human HIST1H2BI 293 Cell Lysate | +Inquiry |
SPATA6L-261HCL | Recombinant Human SPATA6L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB3 Products
Required fields are marked with *
My Review for All macB3 Products
Required fields are marked with *
0
Inquiry Basket