Recombinant Full Length Paracoccidioides Brasiliensis Protein Get1(Get1) Protein, His-Tagged
Cat.No. : | RFL920PF |
Product Overview : | Recombinant Full Length Paracoccidioides brasiliensis Protein GET1(GET1) Protein (C1GC25) (1-207aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Paracoccidioides brasiliensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-207) |
Form : | Lyophilized powder |
AA Sequence : | MPSLLISVLFLHIAIYIINTIAASTIDSLLWLIYMKLPTSASCIAREQHQMKLEVVQLKR EMNATSSQDEFAKWAKLRRRHDKALEEYEVKNKQFSRFKSFFDVAVKALRWAGTSGLIVF LQFWFSKTPIFTLPPSWIPWQVEWVLSFPRAPMGTVSIQVWGGACAVVVALIGEAIGATV RYLYASKDSMEAIKVGAGAVEKEKKRQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GET1 |
Synonyms | GET1; PADG_04547; Protein GET1; Guided entry of tail-anchored proteins 1 |
UniProt ID | C1GC25 |
◆ Recombinant Proteins | ||
EIF4A3-827H | Recombinant Human EIF4A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HERC6-13741H | Recombinant Human HERC6, His-tagged | +Inquiry |
MRPS7-5626H | Recombinant Human MRPS7 Protein, GST-tagged | +Inquiry |
EXOC6-3561H | Recombinant Human EXOC6 Protein, GST-tagged | +Inquiry |
RASD1-4933R | Recombinant Rat RASD1 Protein | +Inquiry |
◆ Native Proteins | ||
S100AA-258B | Native Bovine S-100αα Protein | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
IgGF-330C | Native Chicken IgG Fab | +Inquiry |
AFP-3018P | Native pig AFP | +Inquiry |
C7-56H | Native Human Complement C7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7R-2473MCL | Recombinant Mouse IL7R cell lysate | +Inquiry |
Brain-84M | Mouse Brain Tissue Lysate (7 Days Old) | +Inquiry |
ZNF683-2075HCL | Recombinant Human ZNF683 cell lysate | +Inquiry |
DYNC1H1-519HCL | Recombinant Human DYNC1H1 cell lysate | +Inquiry |
AHI1-41HCL | Recombinant Human AHI1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GET1 Products
Required fields are marked with *
My Review for All GET1 Products
Required fields are marked with *
0
Inquiry Basket