Recombinant Full Length Parabacteroides Distasonis Atp Synthase Subunit B(Atpf) Protein, His-Tagged

• Cat.No.: RFL29315PF
• Product Overview: Recombinant Full Length Parabacteroides distasonis ATP synthase subunit b(atpF) Protein (A6L8N7) (1-166aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length (1-166)
• AA Sequence: MSLLTPDSGLLFWMIVSFGIVFVILSKYGFPVIVKAIEQRKAYIDNSLETARQANERLAH IQAEGEKMLAEAKEKQNAVLKEAFAEKERIIEEARKKAVSEAHLQIEEATRRIREEKEKA IREVRSEIADLSIAIAEKVMKEKIGRDKEQQQMIDRLLDEVSFSKS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Applications: SDS-PAGE
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: atpF
• Synonyms: atpF; BDI_0266; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
• UniProt ID: A6L8N7