Recombinant Full Length Pan Troglodytes 5-Hydroxytryptamine Receptor 1A(Htr1A) Protein, His-Tagged
Cat.No. : | RFL4180PF |
Product Overview : | Recombinant Full Length Pan troglodytes 5-hydroxytryptamine receptor 1A(HTR1A) Protein (Q9N298) (1-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pan troglodytes |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-422) |
Form : | Lyophilized powder |
AA Sequence : | MDVLSPGQGNNTTSPPAPFETGGNTSGISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT RHGASPAQQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC RQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HTR1A |
Synonyms | HTR1A; 5-hydroxytryptamine receptor 1A; 5-HT-1A; 5-HT1A; Serotonin receptor 1A |
UniProt ID | Q9N298 |
◆ Recombinant Proteins | ||
RFL20727CF | Recombinant Full Length Dog 5-Hydroxytryptamine Receptor 1A(Htr1A) Protein, His-Tagged | +Inquiry |
HTR1A-2959R | Recombinant Rat HTR1A Protein | +Inquiry |
HTR1A-2173R | Recombinant Rhesus monkey HTR1A Protein, His-tagged | +Inquiry |
HTR1A-657HF | Recombinant Full Length Human HTR1A Protein | +Inquiry |
RFL22134HF | Recombinant Full Length Human 5-Hydroxytryptamine Receptor 1A(Htr1A) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HTR1A Products
Required fields are marked with *
My Review for All HTR1A Products
Required fields are marked with *
0
Inquiry Basket