Recombinant Full Length Ovis Canadensis Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged
Cat.No. : | RFL6802OF |
Product Overview : | Recombinant Full Length Ovis canadensis NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L) Protein (Q7HLD2) (1-98aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ovis canadensis (Bighorn sheep) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-98) |
Form : | Lyophilized powder |
AA Sequence : | MSLVYMNIMMAFTVSLTGLLMYRSHLMSSLLCLEGMMLSLFILATLMILNSHFTLASMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MT-ND4L |
Synonyms | MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L |
UniProt ID | Q7HLD2 |
◆ Recombinant Proteins | ||
Fkbp15-3022M | Recombinant Mouse Fkbp15 Protein, Myc/DDK-tagged | +Inquiry |
SURA-1615E | Recombinant Escherichia coli SURA Protein (21-428 aa), His-tagged | +Inquiry |
EPCAM-475HAF488 | Active Recombinant Human EPCAM Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
ZSCAN20-3883H | Recombinant Human ZSCAN20, GST-tagged | +Inquiry |
POLL-3328R | Recombinant Rhesus Macaque POLL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-238R | Native Rabbit Immunoglobulin A | +Inquiry |
Lectin-1782G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Biotinylated | +Inquiry |
TNNT2-4655H | Native Human Troponin T Type 2 (Cardiac) | +Inquiry |
IGHE-214H | Native Human Immunoglobulin E (IgE) | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFS1-3898HCL | Recombinant Human NDUFS1 293 Cell Lysate | +Inquiry |
IFNA5-001MCL | Recombinant Mouse IFNA5 cell lysate | +Inquiry |
Pituitary-649B | Bovine Pituitary Lysate, Total Protein | +Inquiry |
COQ6-192HCL | Recombinant Human COQ6 lysate | +Inquiry |
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MT-ND4L Products
Required fields are marked with *
My Review for All MT-ND4L Products
Required fields are marked with *
0
Inquiry Basket