Recombinant Full Length Oryzias Latipes Rhodopsin(Rho) Protein, His-Tagged
Cat.No. : | RFL36465OF |
Product Overview : | Recombinant Full Length Oryzias latipes Rhodopsin(rho) Protein (P87369) (1-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryzias latipes |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-354) |
Form : | Lyophilized powder |
AA Sequence : | MNGTEGPYFNVPMVNTTGIVRSPYEYPQYYLVSPAAYAALGAYMFFLILVGFPINFLTLY VTLEHKKLRTPLNYILLNLAVADLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLG GEIGLWSLVVLAIERWVVVCKPISNFRFGENHAIMGLVFTWIMAASCAVPPLVGWSRYIP EGMQCSCGVDYYTRAEGFNNESFVVYMFVCHFLIPLIVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVVIMVIGFLVCWLPYASVAWYIFTNQGSEFGPLFMTIPAFFAKSSSI YNPAIYICMNKQFRNCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSSVSPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rho |
Synonyms | rho; Rhodopsin; KFH-RH |
UniProt ID | P87369 |
◆ Recombinant Proteins | ||
SCO3883-853S | Recombinant Streptomyces coelicolor A3(2) SCO3883 protein, His-tagged | +Inquiry |
NPM2-10827M | Recombinant Mouse NPM2 Protein | +Inquiry |
CD3D & CD3E-596R | Recombinant Rhesus CD3D & CD3E protein, Fc-Flag & Fc-His-tagged | +Inquiry |
EMD-2767M | Recombinant Mouse EMD Protein, His (Fc)-Avi-tagged | +Inquiry |
vpx-5091H | Recombinant HIV-2 vpx protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
DD-170H | Active Native Human D-Dimer | +Inquiry |
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
TIMP1-91B | Active Native Bovine Thrombin | +Inquiry |
IgG-347G | Native Guinea Pig Gamma Globulin Fraction | +Inquiry |
COL2A1-14B | Native Bovine COL2A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF7-24HCL | Recombinant Human ZNF7 293 Cell Lysate | +Inquiry |
SLC1A4-1798HCL | Recombinant Human SLC1A4 293 Cell Lysate | +Inquiry |
DDX21-7015HCL | Recombinant Human DDX21 293 Cell Lysate | +Inquiry |
SMC4-1649HCL | Recombinant Human SMC4 cell lysate | +Inquiry |
CD1E & B2M-001CCL | Recombinant Cynomolgus CD1E & B2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All rho Products
Required fields are marked with *
My Review for All rho Products
Required fields are marked with *
0
Inquiry Basket