Recombinant Full Length Oryza Sativa Subsp. Japonica Putative Upf0496 Protein 2(Os06G0718300, Loc_Os06G50410) Protein, His-Tagged
Cat.No. : | RFL29820OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Putative UPF0496 protein 2(Os06g0718300, LOC_Os06g50410) Protein (Q5Z8N6) (1-408aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-408) |
Form : | Lyophilized powder |
AA Sequence : | MIERSNSTPSATPARPPLAVDEEYNQAFRSKSFLDLWSHAHHHLTHTFSSFKLSTSTPCA GRGGAREDDFLHAGGDGGAADDSEQSCSYTVLDDFVLEPSPESLARGARLQQRRRRRPRR HRVETLLIEYFDVTEEACEACSALLAAIGAARRHHLTLRRLLLRLDGGDDDDAKDALARH VRLDNPLSPGSLSEFHDVHARCSPLASRLAAAQRRLRRLARALRIARGTAAAALVGACAA AIVAAVVLAAHALVGIGVAAAAFGATPAGAARWWGRRAAEKVSSRHYARAGATLDAAARG AYIVGRDLDTVSRMVRRAHDELEHGRDVARIAMRGHGERPLLQEVAREEEECEEDLRAQL AELEEHVCLCLITINRTRRLVAHEMARGLPPPSPATVTTTSEERLTSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Os06g0718300 |
Synonyms | Os06g0718300; LOC_Os06g50410; OJ1540_H01.15; P0541C02.23; Putative UPF0496 protein 2 |
UniProt ID | Q5Z8N6 |
◆ Recombinant Proteins | ||
BABAM1-946M | Recombinant Mouse BABAM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RARB-31056TH | Recombinant Human RARB | +Inquiry |
MTRF1L-10219M | Recombinant Mouse MTRF1L Protein | +Inquiry |
MECR-3634R | Recombinant Rat MECR Protein | +Inquiry |
TNFAIP6-4863R | Recombinant Rhesus monkey TNFAIP6 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-116R | Native Rabbit Serum Albumin | +Inquiry |
Immunoglobulin G1-81H | Native Human Immunoglobulin G1 | +Inquiry |
C4B-10H | Native Human C4B Protein | +Inquiry |
Protein S-90H | Native Human Protein S | +Inquiry |
TF-5341H | Native Human Transferring | +Inquiry |
◆ Cell & Tissue Lysates | ||
Duodenum-472C | Cat Duodenum Lysate, Total Protein | +Inquiry |
Striatum-558M | MiniPig Striatum Lysate, Total Protein | +Inquiry |
Eye-537E | Equine Eye Lysate, Total Protein | +Inquiry |
ASTN2-141HCL | Recombinant Human ASTN2 cell lysate | +Inquiry |
RFC2-2412HCL | Recombinant Human RFC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Os06g0718300 Products
Required fields are marked with *
My Review for All Os06g0718300 Products
Required fields are marked with *
0
Inquiry Basket