Recombinant Full Length Oryza Sativa Subsp. Japonica Probable Protein Phosphatase 2C 10(Os02G0149800, Loc_Os02G05630) Protein, His-Tagged
Cat.No. : | RFL3892OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Probable protein phosphatase 2C 10(Os02g0149800, LOC_Os02g05630) Protein (Q67UX7) (1-348aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-348) |
Form : | Lyophilized powder |
AA Sequence : | MHGRPSRPLASSSSSSSSRVFSFFLAPRVFLFLVVVVVVVFLPGRSSCWWLEGTEELEEE MGFAGDCSPVSGGGLSENGKFSYGYASAPGKRASMEDFYETRIDGVDGETIGLFGVFDGH GGARAAEYVKQHLFSNLIKHPKFISDIKSAIAETYNHTDSEFLKAESSHTRDAGSTASTA ILVGDRLLVANVGDSRAVVCRGGDAIAVSRDHKPDQSDERQRIEDAGGFVMWAGTWRVGG VLAVSRAFGDKLLKQYVVADPEIKEEIVDSSLEFLILASDGLWDVVSNKEAVDMVRPIQD PEQAAKRLLQEAYQRGSADNITVVIVRFLEGTTTGGGPSREAASDQNS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Os02g0149800 |
Synonyms | Os02g0149800; LOC_Os02g05630; OSJNBa0050G13.3; Probable protein phosphatase 2C 10; OsPP2C10 |
UniProt ID | Q67UX7 |
◆ Recombinant Proteins | ||
DAB2-2192M | Recombinant Mouse DAB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNN1-1750H | Recombinant Human CNN1 Protein, His-tagged | +Inquiry |
SAOUHSC-01402-3652S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01402 protein, His-tagged | +Inquiry |
RFL18408HF | Recombinant Full Length Human Herpesvirus 1 Envelope Glycoprotein E(Ge) Protein, His-Tagged | +Inquiry |
FIP1L1-0307H | Recombinant Human FIP1L1 Protein (S2-E594), Tag Free | +Inquiry |
◆ Native Proteins | ||
GCT-007H | Native Human Gamma glutamyl transferases Protein | +Inquiry |
Skin-008H | Human Skin Lysate, Total Protein | +Inquiry |
IgA-244H | Native Horse Immunoglobulin A | +Inquiry |
IgG-343M | Native MONKEY IgG | +Inquiry |
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFAIP8-895HCL | Recombinant Human TNFAIP8 293 Cell Lysate | +Inquiry |
Caco-2-159H | Caco-2 Whole Cell Lysate | +Inquiry |
MARVELD1-1062HCL | Recombinant Human MARVELD1 cell lysate | +Inquiry |
ARF6-8756HCL | Recombinant Human ARF6 293 Cell Lysate | +Inquiry |
HEK293-014HCL | Human Insulin Stimulated HEK293 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Os02g0149800 Products
Required fields are marked with *
My Review for All Os02g0149800 Products
Required fields are marked with *
0
Inquiry Basket