Recombinant Full Length Oryza Sativa Subsp. Japonica Probable Aquaporin Tip2-2(Tip2-2) Protein, His-Tagged
Cat.No. : | RFL24439OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Probable aquaporin TIP2-2(TIP2-2) Protein (Q5Z6F0) (1-248aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-248) |
Form : | Lyophilized powder |
AA Sequence : | MSGNIAFGRFDDSFSAASLKAYVAEFISTLVFVFAGVGSAIAYTKLTGGAPLDPAGLVAVAVCHGFGLFVAVAIGANISGGHVNPAVTFGLALGGQITILTGVFYWIAQLLGAIVGAVLVQFCTGVATPTHGLSGVGAFEGVVMEIIVTFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGANILVAGPFSGGSMNPARSFGPAVASGDYTNIWIYWVGPLVGGGLAGLVYRYVYMCGDHAPVASSEF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TIP2-2 |
Synonyms | TIP2-2; Os06g0336200; LOC_Os06g22960; OsJ_020360; OSJNBa0012F14.45-1; P0427E01.5-1; Probable aquaporin TIP2-2; Tonoplast intrinsic protein 2-2; OsTIP2;2 |
UniProt ID | Q5Z6F0 |
◆ Recombinant Proteins | ||
EIF4A2-3195H | Recombinant Human EIF4A2 Protein, GST-tagged | +Inquiry |
CALM3-093H | Recombinant Human CALM3 protein, GST-tagged | +Inquiry |
RABGGTB-3582R | Recombinant Rhesus Macaque RABGGTB Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL35731AF | Recombinant Full Length Arabidopsis Thaliana Putative Cyclic Nucleotide-Gated Ion Channel 19(Cngc19) Protein, His-Tagged | +Inquiry |
MUM1-3191H | Recombinant Human MUM1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-117P | Native Porcine Immunoglobulin G | +Inquiry |
LDL-246H | Native Human Lipoproteins, Oxidized LDL (OX-LDL) | +Inquiry |
Collagen-317B | Native Bovine Collagen Type I | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
SHBG-8259H | Native Human Serum Sex Hormone Binding Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYNGR4-1316HCL | Recombinant Human SYNGR4 293 Cell Lysate | +Inquiry |
PAPOLB-470HCL | Recombinant Human PAPOLB lysate | +Inquiry |
FLJ43980-6187HCL | Recombinant Human FLJ43980 293 Cell Lysate | +Inquiry |
KIAA0195-4981HCL | Recombinant Human KIAA0195 293 Cell Lysate | +Inquiry |
ANTXR1-1463HCL | Recombinant Human ANTXR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TIP2-2 Products
Required fields are marked with *
My Review for All TIP2-2 Products
Required fields are marked with *
0
Inquiry Basket