Recombinant Full Length Oryza Sativa Subsp. Japonica Potassium Channel Kor2(Os04G0445000, Loc_Os04G36740) Protein, His-Tagged
Cat.No. : | RFL10280OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Potassium channel KOR2(Os04g0445000, LOC_Os04g36740) Protein (Q7XUW4) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MAEEYELNEIDDTLHGSVGSRLSLFARELKSRRSSSWHGGTALRLPKDLYESLVIHPNGR WYRIWANMMFLWSIYSTFFTPFEFSFFRGLPDQLLDLECVQLVFLADVAVHFFLAYRDPH TYRMVHDKRHIALRYIKGSFALDVLGCFPWDAIYKVTGRVEAVRWLVWVRLYRGRKVMAF FKRVEKDIRVSYLLTRIVKLITVELYCTHTAACGFYYLATTLPPAREGGTWIGSLSLGDA RYINFREVDLLTRYVTSLYLAIVTMATVGYGDIHAVNTREMAFTVVYISFSIVLSAYLIG NMTALIVKGSRTERFRDRMTDLIRYMNRNRLGSAIRSQVKDHLMLQYESSYTRDRVIVDD IPVAVRSKMSQTLYLDMVSRVGLFRGCSDDFLSQIVLKLHEEFFLPGEVILEQGTVVDQI YIVAHGCLEEVANGEDGSEEIISELRPYGIVGDVAVICNIPQPYTVRVCELCSLLRIDKQ SLTSILQIYFKDNSQILSNLLKGKETESKRKQLESDITYLLAKQESELVLGVNNAAYHGD IFRLKSLISAGADPSKSDYDGRTALHIAALRGYENIVRFLIQRGANVNSIDRFGNSPLLQ AVKSGHDRITSLLVEHGAILNLEDAGGYLCRVVRGGRIDLLKKLLRFGISPNCRNYDQRT PLHIAAAEGLHLVASTLIESGADIQAKDRWGNTPLDEGRRCSSKPLVRILEQARTVATN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Os04g0445000 |
Synonyms | Os04g0445000; LOC_Os04g36740; OSJNBa0027P08.8; Potassium channel KOR2; K(+ outward-rectifying channel 2 |
UniProt ID | Q7XUW4 |
◆ Recombinant Proteins | ||
DECR1-26H | Recombinant Human DECR1 protein, MYC/DDK-tagged | +Inquiry |
GNPNAT1-5093H | Recombinant Human GNPNAT1 Protein, GST-tagged | +Inquiry |
TUBGCP3-1250Z | Recombinant Zebrafish TUBGCP3 | +Inquiry |
ZNF684-977HF | Recombinant Full Length Human ZNF684 Protein, GST-tagged | +Inquiry |
RFL32138PF | Recombinant Full Length Erwinia Carotovora Subsp. Atroseptica P-Hydroxybenzoic Acid Efflux Pump Subunit Aaea(Aaea) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
GPT-26882TH | Native Human GPT | +Inquiry |
Y. enterocolitica-31 | Native Yersinia enterocolitica O:9 Antigen | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
ELANE-8104H | Native Human Neutrophil Elastase | +Inquiry |
Ferrous Hemoglobin-033H | Native Human Ferrous Hemoglobin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
ERH-6555HCL | Recombinant Human ERH 293 Cell Lysate | +Inquiry |
RHEBL1-2357HCL | Recombinant Human RHEBL1 293 Cell Lysate | +Inquiry |
CADM3-2556HCL | Recombinant Human CADM3 cell lysate | +Inquiry |
CD27-2415MCL | Recombinant Mouse CD27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Os04g0445000 Products
Required fields are marked with *
My Review for All Os04g0445000 Products
Required fields are marked with *
0
Inquiry Basket