Recombinant Full Length Oryza Sativa Subsp. Japonica Metal Tolerance Protein 6(Mtp6) Protein, His-Tagged
Cat.No. : | RFL34585OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Metal tolerance protein 6(MTP6) Protein (Q0DHJ5) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MAAAAGVAAGTGRGSGEGEELLPNAVEGDGGCGGGGTCAGDRPWRLNFDGLRRPEAHQEK PPRRFHDRLGGLVQSPGDDVAEYYQQQSELLEGFNEMDTLTDRGFLPGMSKEECEKVARS EALAIRLSNIANMVLFAAKVYASIRSGSLAIIASTLDSLLDLLSGFILWFTAFSKKTSNP YRYPIGKRRMQPLGILVFASVMATLGLQIILESTRSLFYDGDTFRLTKEQEKWVVDIMLS VTSVKLLLVVYCRSFTNEILAIYTIRTWSMTVLENVHSLVGQSASPEYLQKLTYLCWNHH KAVRHIDTVRAYTFGSHYFVEVDIVLPCDMPLQEAHDIGEAPQEKLESLPEIERAFVHLD YEFTHQPEHARSHDTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTP6 |
Synonyms | MTP6; Os05g0461900; LOC_Os05g38670; OJ1281_H05.16; OJ1525_A02.3; Metal tolerance protein 6; OsMTP6 |
UniProt ID | Q0DHJ5 |
◆ Recombinant Proteins | ||
SAA3-14635M | Recombinant Mouse SAA3 Protein | +Inquiry |
ELP3-5155M | Recombinant Mouse ELP3 Protein | +Inquiry |
Ucp2-7917M | Recombinant Mouse Ucp2 protein, His-tagged | +Inquiry |
Ace2-105R | Recombinant Rat Ace2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL16220PF | Recombinant Full Length Porphyromonas Gingivalis Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
KRT19-169H | Native Human Cytokeratin 19 | +Inquiry |
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
APCS-8258H | Native Human Serum Amyloid P | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
SHBG-5519H | Native Human Sex Hormone-Binding Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ULBP1-2440HCL | Recombinant Human ULBP1 cell lysate | +Inquiry |
TADA3-1278HCL | Recombinant Human TADA3 293 Cell Lysate | +Inquiry |
Parathyroid-372C | Cynomolgus monkey Parathyroid Lysate | +Inquiry |
Liver-103M | Mouse Liver Tissue Lysate | +Inquiry |
RCAN1-510HCL | Recombinant Human RCAN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTP6 Products
Required fields are marked with *
My Review for All MTP6 Products
Required fields are marked with *
0
Inquiry Basket