Recombinant Full Length Oryza Sativa Subsp. Japonica Metal Tolerance Protein 4(Mtp4) Protein, His-Tagged
Cat.No. : | RFL3648OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Metal tolerance protein 4(MTP4) Protein (Q10PP8) (1-397aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-397) |
Form : | Lyophilized powder |
AA Sequence : | MEAKGENDARAPLLAERRRNSVGSMRGEFVSRLPKKVLDAVDPERPSHVDFSRSKGLREG EKEYYEKQFATLRSFEEVDSIEESNVMSEEDDIAEQKQSEFAMKISNYANMILLALKIYA TIKSGSIAIAASTLDSLLDLMAGGILWFTHLSMKSINVYKYPIGKLRVQPVGIIIFAAVM ATLGFQVFVQAVEKLIVNETPDKLTPVQLTWLYSIMIFATVVKLALWLYCRTSGNKIVRA YAKDHYFDVVTNVVGLAAAVLGDMFYWWIDPVGAIALAVYTITNWSGTVWENAVSLVGES APPEMLQKLTYLAIRHHPQIKRVDTVRAYTFGVLYFVEVDIELPEELPLKEAHAIGESLQ IKIEELPEVERAFVHLDFECDHKPEHNILSKLPSSQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTP4 |
Synonyms | MTP4; Os03g0226400; LOC_Os03g12530; OsJ_09993; OSJNBa0081P02.21; Metal tolerance protein 4; OsMTP4 |
UniProt ID | Q10PP8 |
◆ Native Proteins | ||
Lectin-1794A | Active Native Artocarpus integrifolia Jacalin Protein, Fluorescein labeled | +Inquiry |
TF-102H | Native Human Transferrin (HOLO) | +Inquiry |
IgG-217H | Native Human Immunoglobulin G (IgG) | +Inquiry |
LRP1-18H | Native Human Intermediate Density Lipoproteins Protein | +Inquiry |
Prostate-016H | Human Prostate Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL19-2218HCL | Recombinant Human RPL19 293 Cell Lysate | +Inquiry |
HIST1H4A-5527HCL | Recombinant Human HIST1H4A 293 Cell Lysate | +Inquiry |
FBXO28-6301HCL | Recombinant Human FBXO28 293 Cell Lysate | +Inquiry |
LTBR-1229CCL | Recombinant Cynomolgus LTBR cell lysate | +Inquiry |
SMPD2-614HCL | Recombinant Human SMPD2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTP4 Products
Required fields are marked with *
My Review for All MTP4 Products
Required fields are marked with *
0
Inquiry Basket