Recombinant Full Length Oryza Sativa Subsp. Japonica Metal Tolerance Protein 3(Mtp3) Protein, His-Tagged
Cat.No. : | RFL35646OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Metal tolerance protein 3(MTP3) Protein (Q6Z7K5) (1-410aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-410) |
Form : | Lyophilized powder |
AA Sequence : | MDGDDRRTPLLGGEGGSTRPPSLRRRDSARSLRSTFLSRLPDKVRGGGDPERPAADVDLT RAKGLSQGEKEYYEKQLATLKIFEEVEALCMPGEFESDAEVLELEDKEQKQSESAMKISN YANIILLVFKVYATIKTGSMAIAASTLDSLLDFLAGGILYFTHLTMKSVNIYKYPIGKLR VQPVGIIVFAAIMATLGFQVLIQAIEQLVENKAGEKMTPEQLIWLYSIMLSATVVKLALY IYCRSSGNSIVQAYAKDHYFDVVTNVVGLVAAVLGDKFFWWIDPVGAVLLAVYTIVNWSG TVYENAVTLVGQCAPSDMLQKLTYLAMKHDPRVRRVDTVRAYSFGALYFVEVDIELSEDM RLGEAHSIGESLQDKIEKLPEVERAFVHVDFESTHKPEHRVRSRLPSTEP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTP3 |
Synonyms | MTP3; Os02g0775100; LOC_Os02g53490; OJ1448_G06.19; OsJ_08570; Metal tolerance protein 3; OsMTP3 |
UniProt ID | Q6Z7K5 |
◆ Recombinant Proteins | ||
P2C-P3B-323V | Recombinant HAV P2C-P3B Protein | +Inquiry |
CXCL2-03H | Recombinant Human CXCL2 Protein | +Inquiry |
DIAPH3-1049Z | Recombinant Zebrafish DIAPH3 | +Inquiry |
TRIB2-9589M | Recombinant Mouse TRIB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30026PF | Recombinant Full Length Phaeodactylum Tricornutum Photosystem Ii Reaction Center Protein H(Psbh) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
Lectin-1774E | Active Native Erythrina Cristagalli Lectin Protein, Fluorescein labeled | +Inquiry |
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
Hemocyanin-31S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free, SMCC Activated | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATAD1-6008HCL | Recombinant Human GATAD1 293 Cell Lysate | +Inquiry |
NEFL-3884HCL | Recombinant Human NEFL 293 Cell Lysate | +Inquiry |
SNRK-1626HCL | Recombinant Human SNRK 293 Cell Lysate | +Inquiry |
ALOX5AP-667HCL | Recombinant Human ALOX5AP cell lysate | +Inquiry |
Parotid-377C | Cynomolgus monkey Parotid Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTP3 Products
Required fields are marked with *
My Review for All MTP3 Products
Required fields are marked with *
0
Inquiry Basket