Recombinant Full Length Oryza Sativa Subsp. Japonica Magnesium Transporter Mrs2-A, Chloroplastic(Mrs2-A) Protein, His-Tagged
Cat.No. : | RFL5068OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Magnesium transporter MRS2-A, chloroplastic(MRS2-A) Protein (Q9AUK4) (56-474aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (56-474) |
Form : | Lyophilized powder |
AA Sequence : | AAGRGGAGGLLLLPPLPALRAAEGKDGRAVTKDEEEEAAAAAVEEEGEVEVRREEDKPGD DGSREAAARGSGSGRFSADYISLGIREPVYEVIEVKSNGRMSTKKISRRQLLKSSGLRLR DTRSVDPSLWLMNSMPSLLVREQAILVNLGSLRAIAMHERVLIFNYNSPGGKAFLDSLLP RLNPRNINGGPAMPFQLEVVEAALLSRIQRLERRLMRIEPRVGALLEVLPNRLTADVLEQ LRLSKQALVELGSRAGDLKQMLIDLLDDPHEIRRICIMGRNCTLDKLSDNMECSVPLEKQ IAEEEEEEIEMLLENYLQRCESIHGQAERLLDSAREMEDSIAVNLSSRRLEVSRVELLLQ VGTFCVAIGALIAGIFGMNLKSYLETNAWAFWATTGGIVVGAVAGFFIMYSYLKTRKIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-A |
Synonyms | MRS2-A; Os03g0684400; LOC_Os03g48000; OsJ_12139; OSJNBb0072E24.13; Magnesium transporter MRS2-A, chloroplastic |
UniProt ID | Q9AUK4 |
◆ Recombinant Proteins | ||
RFL5235MF | Recombinant Full Length Mouse Vasoactive Intestinal Polypeptide Receptor 2(Vipr2) Protein, His-Tagged | +Inquiry |
LRRC59-2349H | Recombinant Human LRRC59, His-tagged | +Inquiry |
Atp6v0d1-672M | Recombinant Mouse Atp6v0d1 Protein, MYC/DDK-tagged | +Inquiry |
DCN-73H | Recombinant Human DCN protein(Asp31-Lys359), hFc-tagged | +Inquiry |
IL12RB1-4306H | Recombinant Human IL12RB1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ACTB-325H | Active Native Human ACTB | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
ACTN3-3280C | Native Chicken ACTN3 | +Inquiry |
Fixa-280B | Active Native Bovine Factor IXa - DEGR | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRT7-4864HCL | Recombinant Human KRT7 293 Cell Lysate | +Inquiry |
TRIM74-1836HCL | Recombinant Human TRIM74 cell lysate | +Inquiry |
E2F3-6742HCL | Recombinant Human E2F3 293 Cell Lysate | +Inquiry |
PSMB5-2771HCL | Recombinant Human PSMB5 293 Cell Lysate | +Inquiry |
PADI4-630HCL | Recombinant Human PADI4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2-A Products
Required fields are marked with *
My Review for All MRS2-A Products
Required fields are marked with *
0
Inquiry Basket