Recombinant Full Length Oryza Sativa Subsp. Indica Peroxisomal Membrane Protein 11-4(Pex11-4) Protein, His-Tagged
Cat.No. : | RFL8147OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. indica Peroxisomal membrane protein 11-4(PEX11-4) Protein (Q01IH3) (1-222aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-222) |
Form : | Lyophilized powder |
AA Sequence : | MSAGDTLDKLVVFLAKRDGIDKLVKTFQYVSKLAHWAAESSSPGLAGRAKNWETSAGLSR KAFRTGRFLTGLNGLRRAPGEFGALAVLANAGEMVYFFFDHFTWLSRVGVLDAWLARRMS FISAFGESVGYVFFIAMDLIMIRRGLRQERKLLREGGKDKDKEVKKIRMDRVMRLMATAA NVADLVIGIADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PEX11-4 |
Synonyms | PEX11-4; OsI_016204; OSIGBa0159I10.12; Peroxisomal membrane protein 11-4; OsPEX11-4; Peroxin-11-4 |
UniProt ID | Q01IH3 |
◆ Recombinant Proteins | ||
TNFRSF11A-235H | Recombinant Human TNFRSF11A Protein, His (Fc)-Avi-tagged | +Inquiry |
RPL27A-5120R | Recombinant Rat RPL27A Protein | +Inquiry |
RFL30794BF | Recombinant Full Length Beta Vulgaris Atp Synthase Subunit 9, Mitochondrial(Atp9) Protein, His-Tagged | +Inquiry |
HAUS5-2468H | Recombinant Human HAUS5 protein, His-tagged | +Inquiry |
TMEM215-9358M | Recombinant Mouse TMEM215 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GCT-007H | Native Human Gamma glutamyl transferases Protein | +Inquiry |
SERPINC1-26143TH | Native Human SERPINC1 | +Inquiry |
APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
AZU1-40H | Native Human Azurocidin | +Inquiry |
Lectin-1828P | Active Native Pisum Sativum Agglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
VN1R1-401HCL | Recombinant Human VN1R1 293 Cell Lysate | +Inquiry |
Daudi-018HCL | Human Daudi Whole Cell Lysate | +Inquiry |
Lymph node-332H | Human Lymph node Membrane Lysate | +Inquiry |
SPDYE2-1523HCL | Recombinant Human SPDYE2 293 Cell Lysate | +Inquiry |
AP1AR-8820HCL | Recombinant Human AP1AR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PEX11-4 Products
Required fields are marked with *
My Review for All PEX11-4 Products
Required fields are marked with *
0
Inquiry Basket