Recombinant Full Length Oryza Sativa Subsp. Indica Magnesium Transporter Mrs2-I(Mrs2-I) Protein, His-Tagged
Cat.No. : | RFL20477OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. indica Magnesium transporter MRS2-I(MRS2-I) Protein (B8AJT9) (1-381aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-381) |
Form : | Lyophilized powder |
AA Sequence : | MAAAVVVAGEAAAAAGAGGKKRGASRSWILFDAAGEERVLDADKYAIMHRVDINARDLRI LDPLLSYPSTILGRERAIVLNLEHIKAIITAEEVLLRDPLDDNVIPVVEELRRRLAPSSA TQHDVEGAEEDESPFEFRALEVTLEAICSFLGARTTELESAAYPALDELTSKISSRNLDR VRKLKSGMTRLNARVQKVRDELEQLLDDDDDMADLYLSRKLAGAASPVSGSGGPNWFPAS PTIGSKISRASRASAPTIHGNENDVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTEDYI NIQLDNHRNQLIQLELFLSSGTVCLSLYSLVAGIFGMNIPYTWNDNHGYVFKWVVLVSGL FCAFMFVSIVAYARHKGLVGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-I |
Synonyms | MRS2-I; OsI_13458; Magnesium transporter MRS2-I |
UniProt ID | B8AJT9 |
◆ Recombinant Proteins | ||
DCX-5907C | Recombinant Chicken DCX | +Inquiry |
SH-RS10280-5276S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS10280 protein, His-tagged | +Inquiry |
SNTA1-29288TH | Recombinant Human SNTA1, His-tagged | +Inquiry |
MRPL48-6432HF | Recombinant Full Length Human MRPL48 Protein, GST-tagged | +Inquiry |
TMEM41B-9397M | Recombinant Mouse TMEM41B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
AMY1A-8023H | Native Human Salivary Amylase (Alpha) | +Inquiry |
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
TF-8271H | Native Human Serum Transferrin APO (Iron Free) | +Inquiry |
Collagen-46M | Native Mouse Collagen protein | +Inquiry |
FGG -57R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFI27L2-5294HCL | Recombinant Human IFI27L2 293 Cell Lysate | +Inquiry |
STK40-408HCL | Recombinant Human STK40 cell lysate | +Inquiry |
DOLPP1-231HCL | Recombinant Human DOLPP1 lysate | +Inquiry |
CCNJL-7702HCL | Recombinant Human CCNJL 293 Cell Lysate | +Inquiry |
LOXL4-4676HCL | Recombinant Human LOXL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2-I Products
Required fields are marked with *
My Review for All MRS2-I Products
Required fields are marked with *
0
Inquiry Basket