Recombinant Full Length Orgyia Pseudotsugata Multicapsid Polyhedrosis Virus Major Envelope Glycoprotein(Gp64) Protein, His-Tagged
Cat.No. : | RFL18876OF |
Product Overview : | Recombinant Full Length Orgyia pseudotsugata multicapsid polyhedrosis virus Major envelope glycoprotein(GP64) Protein (P13625) (18-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Orgyia pseudotsugata multicapsid polyhedrosis virus (OpMNPV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-509) |
Form : | Lyophilized powder |
AA Sequence : | AEHCNAQMKSGPWRIKSLPIAAPKETLQKDVEIEIVETDLDQNVVIGYKGYYQAYAYNGG SLDPNSRVEETMKTLDVAKEDLLMWGIRQQCEVGEELIDQWGSDSESCFRNMDGRGVWVA GKELVKRQNNNHFAHHTCNRSWRCGVSTAKMYTRLECDDDTDDCKVTILDINGTSINVTE NKVLHRDGVSMILKQKSTFSRRTEKVACLLIKDDKADPNSVTREHCLVDNDIFDLSKNTW FCKFNRCIKRRSENVVKQRPHTWRHDRPPKHDEGATATKGDLMHIQEELMYENDLLRMNL ELMHAHINKLNNMMHDLIVSVAKVDERLIGNLMNNSVSSTFLSDDTFLLMPCTSPPPHTS NCYNNSIYKEGRWVANTDTSQCIDFNNYKELAIDDDIEFWIPTIGNTSYHESWKDASGWS FIAQQKSNLISTMENTKFGGHTTSLSDIADMAKGELNATLYSFMLGHGFTFVLIVGVILF LVCMLRNRPSHY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GP64 |
Synonyms | GP64; P64; ORF126; Major envelope glycoprotein; gp64 |
UniProt ID | P13625 |
◆ Native Proteins | ||
CTSB-5328H | Native Human Cathepsin B | +Inquiry |
Factor XIII-67H | Native Human Factor XIII | +Inquiry |
HbA1c-199H | Native Human Hemoglobin A1C | +Inquiry |
COL2A1-13B | Native Bovine COL2A1 Protein | +Inquiry |
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPLX3-777HCL | Recombinant Human CPLX3 cell lysate | +Inquiry |
FZD7-6088HCL | Recombinant Human FZD7 293 Cell Lysate | +Inquiry |
UNC5CL-1887HCL | Recombinant Human UNC5CL cell lysate | +Inquiry |
AKR1E2-51HCL | Recombinant Human AKR1E2 cell lysate | +Inquiry |
MTG1-1145HCL | Recombinant Human MTG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GP64 Products
Required fields are marked with *
My Review for All GP64 Products
Required fields are marked with *
0
Inquiry Basket