Recombinant Full Length Oreochromis Niloticus G-Protein Coupled Receptor 54(Gpr54) Protein, His-Tagged
Cat.No. : | RFL13234OF |
Product Overview : | Recombinant Full Length Oreochromis niloticus G-protein coupled receptor 54(gpr54) Protein (Q6BD04) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oreochromis niloticus (Nile tilapia) (Tilapia nilotica) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MYSSEELWNSTEQVWINGSGTNFSLGRHEDDEEEEGDKHPFFTDAWLVPLFFSLIMLVGL VGNSLVIYVISKHRQMRTATNFYIANLAATDIIFLVCCVPFTATLYPLPGWIFGNFMCKF VAFLQQVTVQATCITLTAMSGDRCYVTVYPLKSLRHRTPKVAMIVSICIWIGSFVLSTPI LMYQRIEEGYWYGPRQYCMERFPSKTHERAFILYQFIAAYLLPVLTISFCYTLMVKRVGQ PTVEPVDNNYQVNLLSERTISIRSKVSKMVVVIVLLFAICWGPIQIFVLFQSFYPNYQPN YATYKIKTWANCMSYANSSVNPIVYGFMGASFQKSFRKTFPFLFKHKVRDSSMASRTANA EIKFVAAEEGNNNNAVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gpr54 |
Synonyms | gpr54; G-protein coupled receptor 54 |
UniProt ID | Q6BD04 |
◆ Recombinant Proteins | ||
HCVMB-109H | Recombinant Hepatitis C Virus HCVMB protein | +Inquiry |
RFL22799CF | Recombinant Full Length Photosystem Ii D2 Protein(Psbd) Protein, His-Tagged | +Inquiry |
Matn4-1060M | Active Recombinant Mouse Matn4 Protein, His-tagged | +Inquiry |
EGF-62H | Recombinant Active Human EGF Protein, His-tagged(C-ter) | +Inquiry |
ISOC2-5768HF | Recombinant Full Length Human ISOC2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LRG1-3684H | Native Human LRG1 | +Inquiry |
F2-303R | Native Rat Thrombin | +Inquiry |
LYZ-5316H | Native Human Lysozyme(salivary) | +Inquiry |
Trf-4782M | Native Mouse Transferrin | +Inquiry |
TG-8265H | Native Human Thyroids Thyroglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAS1R1-1249HCL | Recombinant Human TAS1R1 293 Cell Lysate | +Inquiry |
NCKIPSD-1173HCL | Recombinant Human NCKIPSD cell lysate | +Inquiry |
MAPK14-001HCL | Recombinant Human MAPK14 cell lysate | +Inquiry |
ZNF333-2013HCL | Recombinant Human ZNF333 cell lysate | +Inquiry |
HIST1H3G-5529HCL | Recombinant Human HIST1H3G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All gpr54 Products
Required fields are marked with *
My Review for All gpr54 Products
Required fields are marked with *
0
Inquiry Basket