Recombinant Full Length Olimarabidopsis Pumila Apocytochrome F(Peta) Protein, His-Tagged
Cat.No. : | RFL18520OF |
Product Overview : | Recombinant Full Length Olimarabidopsis pumila Apocytochrome f(petA) Protein (A4QJZ7) (36-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Olimarabidopsis pumila (Dwarf rocket) (Arabidopsis griffithiana) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (36-320) |
Form : | Lyophilized powder |
AA Sequence : | YPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEIKEKIGTLSFQNYRPNKKNILVIGPVPG QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATTGGIIS KILRKEKGGYEITIVDASNGREVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petA |
Synonyms | petA; Cytochrome f |
UniProt ID | A4QJZ7 |
◆ Native Proteins | ||
LDL-12H | Native Human LDL Protein | +Inquiry |
CTSL1-27406TH | Native Human CTSL1 | +Inquiry |
KLK4-239R | Native Rat Kallikrein | +Inquiry |
Elastase-26P | Native Pseudomonas Aeruginosa Elastase | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A6E-420HCL | Recombinant Human MS4A6E lysate | +Inquiry |
PSG9-2783HCL | Recombinant Human PSG9 293 Cell Lysate | +Inquiry |
RAD23B-2558HCL | Recombinant Human RAD23B 293 Cell Lysate | +Inquiry |
VPS28-392HCL | Recombinant Human VPS28 293 Cell Lysate | +Inquiry |
MARCH2-4473HCL | Recombinant Human MARCH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All petA Products
Required fields are marked with *
My Review for All petA Products
Required fields are marked with *
0
Inquiry Basket