Recombinant Full Length Oenothera Elata Subsp. Hookeri Nad(P)H-Quinone Oxidoreductase Subunit 4L, Chloroplastic(Ndhe) Protein, His-Tagged
Cat.No. : | RFL14455OF |
Product Overview : | Recombinant Full Length Oenothera elata subsp. hookeri NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic(ndhE) Protein (Q9MTI0) (1-101aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-101) |
Form : | Lyophilized powder |
AA Sequence : | MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNSVNLNFVTFSDFFDSRQLKGD IFSIFIIAIAAAEAAIGLAIVSSIYRNRKSIRINQSNLLNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhE |
Synonyms | ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L |
UniProt ID | Q9MTI0 |
◆ Recombinant Proteins | ||
PCDHB15-3830H | Recombinant Human PCDHB15 protein, His-tagged | +Inquiry |
PDGFB-4838H | Recombinant Human PDGFB Protein (Glu21-Ala241), C-His tagged | +Inquiry |
CXCL10-4342C | Recombinant Caprine CXCL10 Protein | +Inquiry |
NDNF-5954M | Recombinant Mouse NDNF Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL22184EF | Recombinant Full Length Escherichia Fergusonii Upf0283 Membrane Protein Ycjf(Ycjf) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
HSV1-15 | Native Herpes Simplex Virus (HSV) Type 1 Antigen | +Inquiry |
IGHE-214H | Native Human Immunoglobulin E (IgE) | +Inquiry |
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
VTN-385P | Native Pig Vitronectin | +Inquiry |
MMP9-41H | Native Human MMP-9/TIMP-1 Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
Kidney-270R | Rhesus monkey Kidney Membrane Lysate | +Inquiry |
RPSAP58-1011HCL | Recombinant Human RPSAP58 cell lysate | +Inquiry |
GINS3-5932HCL | Recombinant Human GINS3 293 Cell Lysate | +Inquiry |
SLAMF8-2093MCL | Recombinant Mouse SLAMF8 cell lysate | +Inquiry |
MBD5-1066HCL | Recombinant Human MBD5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhE Products
Required fields are marked with *
My Review for All ndhE Products
Required fields are marked with *
0
Inquiry Basket