Recombinant Full Length Ochrobactrum Anthropi Upf0283 Membrane Protein Oant_2119 (Oant_2119) Protein, His-Tagged
Cat.No. : | RFL10105OF |
Product Overview : | Recombinant Full Length Ochrobactrum anthropi UPF0283 membrane protein Oant_2119 (Oant_2119) Protein (A6X0T1) (1-360aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ochrobactrum anthropi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-360) |
Form : | Lyophilized powder |
AA Sequence : | MTEKTPRKPASFTVSQASNRPEAADEAPRRPRAVRDLDVVVAQPDVFALSEEEAAELEIL DPSFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFSRADWLGWTALGVAIIAL AAFIAIVVRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRSIAAGLPETARGR QLLDGLTDDIIDGRNLIQLAETEILRPLDREARTLILNASKRVSIVTAISPRALVDIGYV IFESARLIRRLSQLYGGRPGTLGFLKLARRVIAHLAVTGTLAMGDSVIQQLVGHGLASRL SAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLVKINGERPDKKHPGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Oant_2119 |
Synonyms | Oant_2119; UPF0283 membrane protein Oant_2119 |
UniProt ID | A6X0T1 |
◆ Recombinant Proteins | ||
ELMOD1-1447R | Recombinant Rhesus monkey ELMOD1 Protein, His-tagged | +Inquiry |
CTTNBP2NL-2368HF | Recombinant Full Length Human CTTNBP2NL Protein, GST-tagged | +Inquiry |
YDJM-2931B | Recombinant Bacillus subtilis YDJM protein, His-tagged | +Inquiry |
TRPM4-5958R | Recombinant Rat TRPM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCLK2-1452R | Recombinant Rat DCLK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
C4A-158H | Native Human C4A protein | +Inquiry |
LDL-401H | Native Human Low Density Lipoprotein, Medium Oxidized, DiI labeled | +Inquiry |
Lectin-1771D | Active Native Dolichos Biflorus Lectin Protein | +Inquiry |
F10-296M | Active Native Mouse Factor Xa | +Inquiry |
C4B-1846H | Native Human C4B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM55B-941HCL | Recombinant Human TMEM55B 293 Cell Lysate | +Inquiry |
GZMB-2944HCL | Recombinant Human GZMB cell lysate | +Inquiry |
GPR26-5789HCL | Recombinant Human GPR26 293 Cell Lysate | +Inquiry |
GZMA-5668HCL | Recombinant Human GZMA 293 Cell Lysate | +Inquiry |
PIGR-2867MCL | Recombinant Mouse PIGR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Oant_2119 Products
Required fields are marked with *
My Review for All Oant_2119 Products
Required fields are marked with *
0
Inquiry Basket