Recombinant Full Length O'Nyong-Nyong Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL28409OF |
Product Overview : | Recombinant Full Length O'nyong-nyong virus Structural polyprotein Protein (O90371) (809-1247aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | O'nyong-nyong Virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (809-1247) |
Form : | Lyophilized powder |
AA Sequence : | YEHATVIPNTVGVPYKTLVSRPGYSPMVLEMELQSVTLEPTLFLDYITCEYKTITPSPYV KCCGTAECKAKNLPDYNCKVFTGVYPFMWGGAYCFCDAENTQLSEAHVEKSESCKTEFAS AYRAHTASVSAKLRVFYQGNNITVSAYANGDHAVTVKDAKFVIGPLSSAWSPFDNKIVVY KGEVYNMDYPPFGAGRPGQFGDIQSRTPDSKDVYANTQLILQRPAAGAIHVPYSQAPSGF KYWLKEKGASLQHTAPFGCQIATNPVRAVNCAVGNIPVSIDIPDAAFTRVTDAPSVTDMS CEVASCTHSSDFGGAAVIKYTASKKGKCAVHSLTNAVTIREPNVDVEGTAQLQIAFSTAL ASAEFKVQICSTQVHCSATCHPPKDHIVNYPSPHTTLGVQDISTTAMSWVQKITGGVGLV VAIAALILIIVLCVSFSRH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | O'nyong-nyong virus Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | O90371 |
◆ Recombinant Proteins | ||
ASB11-1355HF | Recombinant Full Length Human ASB11 Protein, GST-tagged | +Inquiry |
ASNA1-2559H | Recombinant Human ASNA1 protein, His-SUMO-tagged | +Inquiry |
CLK4-1761M | Recombinant Mouse CLK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL11554GF | Recombinant Full Length Gossypium Hirsutum Photosystem I Assembly Protein Ycf4(Ycf4) Protein, His-Tagged | +Inquiry |
TPBG-4992HFL | Recombinant Full Length Human TPBG protein, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
Hyaluronidase-34O | Active Native Ovine Hyaluronidase | +Inquiry |
APOA1-8344H | Native Human APOA1 | +Inquiry |
LOX3-11S | Native Soybeans LOX3 Protein | +Inquiry |
IgG-224M | Native Mouse Immunoglobulin G | +Inquiry |
APOC2-27332TH | Native Human APOC2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST6-1632MCL | Recombinant Mouse CST6 cell lysate | +Inquiry |
CDC2L2-7661HCL | Recombinant Human CDC2L2 293 Cell Lysate | +Inquiry |
Brain-132R | Rat Brain Tissue Lysate | +Inquiry |
MAGEB10-4547HCL | Recombinant Human MAGEB10 293 Cell Lysate | +Inquiry |
RNPC3-2261HCL | Recombinant Human RNPC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All O'nyong-nyong virus Structural polyprotein Products
Required fields are marked with *
My Review for All O'nyong-nyong virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket