Recombinant Full Length Nymphaea Alba Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL5912NF |
Product Overview : | Recombinant Full Length Nymphaea alba NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q6EVZ5) (1-361aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nymphaea alba (White water-lily) (Castalia alba) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-361) |
Form : | Lyophilized powder |
AA Sequence : | MIIEEAQAINSFFRSESSKEVYGLIWLLVPILTLVLGITIGVLVIVWLERKISAGIQRRI GPEYAGPLGILQALADGVKLLFKEDLLPSRGDIRLFSVGPSVAVVSILLSYSVIPFGYHL VLTDLSIGVFLWIAISSIAPIGLLMSGYGSNNKYSFSGGLRAAAQSISYEIPLTPCVLSI SLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFLVFIISSLAECERLPFDLPEAEEELVA GYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLPIPYIPITELFEINKTSEVFG TTISLLITLAKAYLFLFIPISTRWTLPRLRMDQLLNLGWKSLLPIALGNLLLTTSSQLVS L |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q6EVZ5 |
◆ Recombinant Proteins | ||
ITGA4-161H | Recombinant Human ITGA4 & ITGB1, Flag & His tagged | +Inquiry |
Mccc1-8173M | Recombinant Mouse Mccc1 protein, His & T7-tagged | +Inquiry |
CCND1-1140H | Recombinant Human CCND1 Protein (Lue65-Arg245), His tagged | +Inquiry |
GPM6B-1937R | Recombinant Rhesus monkey GPM6B Protein, His-tagged | +Inquiry |
UCMA-2511H | Recombinant Human UCMA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CFB-104H | Native Human Factor B | +Inquiry |
MPOB-234H | Native Human Myeloperoxidase Isoform B | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
GPT-65H | Active Native Human Glutamate Pyruvate Transaminase (GPT) | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIP5K3-1354HCL | Recombinant Human PIP5K3 cell lysate | +Inquiry |
CYP2A13-433HCL | Recombinant Human CYP2A13 cell lysate | +Inquiry |
CRELD2-001MCL | Recombinant Mouse CRELD2 cell lysate | +Inquiry |
RAB23-2618HCL | Recombinant Human RAB23 293 Cell Lysate | +Inquiry |
KLC1-4935HCL | Recombinant Human KLC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket