Recombinant Full Length Nuphar Advena Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic Protein, His-Tagged
Cat.No. : | RFL15104NF |
Product Overview : | Recombinant Full Length Nuphar advena NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic Protein (A1XG10) (1-361aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nuphar advena (Common spatterdock) (Nuphar lutea subsp. advena) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-361) |
Form : | Lyophilized powder |
AA Sequence : | MIIEEAQAINSFFRSESSKEVYGLIWLLVPILTLVLGITIGVLVIVWLERKISAGIQRRI GPEYAGPLGILQALADGVKLLFKEDLLPSRGDIRLFSVGPSIAVVSILLSYSVIPFGHHL VLTDLSIGVSLWIAISSIAPIGLLMSGYGSNNKYSFSGGLRAAAQSISYEIPLTPCVLSI SLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFIVFIISSLAECERLPFDLPEAEEELVA GYQTEYSGIKFGLFYVASYLNLLVSSLFVTILYLGGWNLSIPYIPITELFEKNQTSEVFG TTISLLITLAKAYLFLFIPISTRWTLPRMRMDQLLNLGWKSLLPIALGNLLLTTSSQLVS L |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | A1XG10 |
◆ Recombinant Proteins | ||
CA11-1153M | Recombinant Mouse CA11 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTF1-122H | Active Recombinant Human CTF1 protein | +Inquiry |
EBNA1BP2-4146HF | Recombinant Full Length Human EBNA1BP2 Protein, GST-tagged | +Inquiry |
Gng8-1039M | Recombinant Mouse Gng8 Protein, MYC/DDK-tagged | +Inquiry |
YXAJ-2295B | Recombinant Bacillus subtilis YXAJ protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
THBS1-4946H | Native Human Thrombospondin protein | +Inquiry |
PLAT-30946TH | Native Human PLAT | +Inquiry |
Lectin-1806L | Active Native Lycopersicon Esculentum Lectin Protein | +Inquiry |
F9-5405M | Native Mouse Coagulation Factor IX | +Inquiry |
IgG-349H | Native Horse Gamma Globulin Fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
Ureter-546H | Human Ureter Membrane Tumor Lysate | +Inquiry |
C6orf136-7995HCL | Recombinant Human C6orf136 293 Cell Lysate | +Inquiry |
C5orf56-8006HCL | Recombinant Human C5orf56 293 Cell Lysate | +Inquiry |
RPS6-567HCL | Recombinant Human RPS6 lysate | +Inquiry |
SPINT1-2027HCL | Recombinant Human SPINT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket