Recombinant Full Length Nucleoside-Triphosphatase Ntp-1(Ntp-1) Protein, His-Tagged
Cat.No. : | RFL16495CF |
Product Overview : | Recombinant Full Length Nucleoside-triphosphatase ntp-1(ntp-1) Protein (Q18411) (1-485aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-485) |
Form : | Lyophilized powder |
AA Sequence : | MSGGSSERVQRSVRSVVETKNNIKYGVICDAGSSGTRLFVYTLKPLSGGLTNIDTLIHES EPVVKKVTPGLSSFGDKPEQVVEYLTPLLRFAEEHIPYEQLGETDLLIFATAGMRLLPEA QKDAIIKNLQNGLKSVTALRVSDSNIRIIDGAWEGIYSWIAVNYILGRFDKENDSKVGMI DMGGASVQIAFEIANEKESYNGGNVYEINLGSIETNEDYKYKIYSTTFLGYGANEGLKKY ENSLVKSGNSNDSCSPRGLNRLIGEFTVNGTGEWDVCLAQVSSLIGDKAQPSCPNPTCFL RNVIAPSVNLSTVQLYGFSEYWYTTSNFGSGGEYHYQKFTDEVRKYCQKDWNDIQDGFKR NEFPNADIERLGTNCFKAAWVTSVLHDGFNVDKTKHLFQSVLKIAGEEMQWALGAMLYHS KDLKFNLLEQLEVAQSTQQISNFFSFFVILIIVLAVALYRQLQSESTYKKYNFLRTDSKP DFLNV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ntp-1 |
Synonyms | ntp-1; C33H5.14; Nucleoside-triphosphatase ntp-1 |
UniProt ID | Q18411 |
◆ Recombinant Proteins | ||
LRP1-4697H | Recombinant Human LRP1 Protein, GST-tagged | +Inquiry |
Hdac7-3370M | Recombinant Mouse Hdac7 Protein, Myc/DDK-tagged | +Inquiry |
HGD-1174H | Recombinant Human HGD protein, His-tagged | +Inquiry |
YHFJ-2488B | Recombinant Bacillus subtilis YHFJ protein, His-tagged | +Inquiry |
RFL2546EF | Recombinant Full Length Escherichia Coli N-Acetylgalactosamine Permease Iid Component(Agad) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CLU-19H | Native Human Clusterin Protein | +Inquiry |
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
Actin-340R | Native Rabbit Actin Protein | +Inquiry |
BPE-138 | Native Red algae B-Phycoerythrin protein | +Inquiry |
MUC1-376H | Active Native Human MUC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT2A-4096HCL | Recombinant Human MT2A 293 Cell Lysate | +Inquiry |
C1orf115-8185HCL | Recombinant Human C1orf115 293 Cell Lysate | +Inquiry |
A-172-029HCL | Human A-172 Whole Cell Lysate | +Inquiry |
ARHGAP5-8737HCL | Recombinant Human ARHGAP5 293 Cell Lysate | +Inquiry |
STAP2-1424HCL | Recombinant Human STAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ntp-1 Products
Required fields are marked with *
My Review for All ntp-1 Products
Required fields are marked with *
0
Inquiry Basket