Recombinant Full Length Nostoc Sp. Photosystem Ii Reaction Center Protein H(Psbh) Protein, His-Tagged
Cat.No. : | RFL20521NF |
Product Overview : | Recombinant Full Length Nostoc sp. Photosystem II reaction center protein H(psbH) Protein (Q8YYK2) (1-62aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nostoc sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-62) |
Form : | Lyophilized powder |
AA Sequence : | MAQRTRLGDILRPLNSEYGKVAPGWGTTPVMGVFMALFLVFLLIILQLYNKSILIQDVRV GW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbH |
Synonyms | psbH; asl0846; Photosystem II reaction center protein H; PSII-H |
UniProt ID | Q8YYK2 |
◆ Recombinant Proteins | ||
KCTD6-5873H | Recombinant Human KCTD6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SUCNR1-8854M | Recombinant Mouse SUCNR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLAC8L1-6809M | Recombinant Mouse PLAC8L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SELE-5514R | Recombinant Rabbit SELE protein, His-tagged | +Inquiry |
SHC1-1005H | Recombinant Human SHC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Y. enterocolitica-30 | Native Yersinia enterocolitica O:8 Antigen | +Inquiry |
LYZ-249H | Active Native Human Lysozyme | +Inquiry |
CAT-26409TH | Native Human CAT | +Inquiry |
CPA-01B | Native Bovine Pancreas Carboxypeptidase A, Type II-PMSF treated | +Inquiry |
FBa-12H | Native Human Factor Ba protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
STK19-1713HCL | Recombinant Human STK19 cell lysate | +Inquiry |
ABHD1-8HCL | Recombinant Human ABHD1 cell lysate | +Inquiry |
DCAF15-7057HCL | Recombinant Human DCAF15 293 Cell Lysate | +Inquiry |
ELAVL3-6636HCL | Recombinant Human ELAVL3 293 Cell Lysate | +Inquiry |
NOV-001CCL | Recombinant Cynomolgus NOV cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbH Products
Required fields are marked with *
My Review for All psbH Products
Required fields are marked with *
0
Inquiry Basket