Recombinant Full Length Nostoc Sp. Cytochrome B6-F Complex Subunit 4(Petd) Protein, His-Tagged
Cat.No. : | RFL5813DF |
Product Overview : | Recombinant Full Length Nostoc sp. Cytochrome b6-f complex subunit 4(petD) Protein (P12117) (1-160aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Desmonostoc sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-160) |
Form : | Lyophilized powder |
AA Sequence : | MATQKKPDLSDPQLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFAAIVALAVLDPA MTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKF QNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petD |
Synonyms | petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide |
UniProt ID | P12117 |
◆ Recombinant Proteins | ||
MYH3-905HFL | Recombinant Full Length Human MYH3 Protein, C-Flag-tagged | +Inquiry |
ZGLP1-19171M | Recombinant Mouse ZGLP1 Protein | +Inquiry |
ZBTB9-088H | Recombinant Human ZBTB9 Protein, HIS-tagged | +Inquiry |
MPXV-0383 | Recombinant Monkeypox Virus D10L Protein, Interferon antagonist C7 | +Inquiry |
CRYAA-3933M | Recombinant Mouse CRYAA Protein | +Inquiry |
◆ Native Proteins | ||
IgG-343M | Native MONKEY IgG | +Inquiry |
IgG-349H | Native Horse Gamma Globulin Fraction | +Inquiry |
Mucin-313 | Native Porcine Mucin Type III protein | +Inquiry |
ACTA1-157R | Native Rabbit skeletal muscle alpha Actin | +Inquiry |
Lectin-1727W | Native Wheat Germ Lectin, Biotin conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
Jejunum-255H | Human Jejunum Membrane Lysate | +Inquiry |
LSM3-9174HCL | Recombinant Human LSM3 293 Cell Lysate | +Inquiry |
IGL-846HCL | Recombinant Human IGL cell lysate | +Inquiry |
XPOT-1939HCL | Recombinant Human XPOT cell lysate | +Inquiry |
SF295-012WCY | Human Glioblastoma SF295 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All petD Products
Required fields are marked with *
My Review for All petD Products
Required fields are marked with *
0
Inquiry Basket