Recombinant Full Length Nostoc Sp. Cobalt Transport Protein Cbim(Cbim) Protein, His-Tagged
Cat.No. : | RFL9667NF |
Product Overview : | Recombinant Full Length Nostoc sp. Cobalt transport protein CbiM(cbiM) Protein (Q8YQ91) (34-261aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nostoc sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (34-261) |
Form : | Lyophilized powder |
AA Sequence : | MHIMEGYLPAGWAAFWWLVALPFMLLGVRSLTRITKANPELKLLLALAGAFTFVLSALKL PSVTGSCSHPTGTGLGSVLFGPLAMSVLGSLVLLFQALLLAHGGLTTLGANAFSMAIAGP FAAYWIYHLTIKLTGKQRIAIFLAATLADLLTYIITSVQLALAFPAPVGGFIASFAKFAG IFAITQIPLAISEGLLTVLVWNWLQSYSPQELQLLKLIQGESQSHESI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cbiM |
Synonyms | cbiM; alr3943; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM |
UniProt ID | Q8YQ91 |
◆ Recombinant Proteins | ||
ECD-929H | Recombinant Human ECD Protein, MYC/DDK-tagged | +Inquiry |
CDC25A-1987HFL | Recombinant Full Length Human CDC25A Protein, C-Flag-tagged | +Inquiry |
RFL30688BF | Recombinant Full Length Bovine Transmembrane Protein 182(Tmem182) Protein, His-Tagged | +Inquiry |
AS3MT-3675Z | Recombinant Zebrafish AS3MT | +Inquiry |
CDX1B-5719Z | Recombinant Zebrafish CDX1B | +Inquiry |
◆ Native Proteins | ||
GG-193R | Native Rat Gamma Globulin protein | +Inquiry |
CT-34 | Native Chlamydia trachomatis Antigen | +Inquiry |
Fibrinogen-70P | Active Native Porcine Fibrinogen | +Inquiry |
Collagen-121B | Native Bovine Type II Collagen, FITC-tagged | +Inquiry |
Lectin-1729G | Active Native Griffonia Simplicifolia Lectin I Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DKK3-2672MCL | Recombinant Mouse DKK3 cell lysate | +Inquiry |
NACA-2129HCL | Recombinant Human NACA cell lysate | +Inquiry |
NA-2811HCL | Recombinant H1N1 NA cell lysate | +Inquiry |
Fetal Brain-131H | Human Fetal Brain Membrane Lysate | +Inquiry |
NP-004HCL | Recombinant H5N1 NP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cbiM Products
Required fields are marked with *
My Review for All cbiM Products
Required fields are marked with *
0
Inquiry Basket