Recombinant Full Length Nostoc Sp. Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL2118NF |
Product Overview : | Recombinant Full Length Nostoc sp. ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (Q8YMZ8) (1-656aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nostoc sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-656) |
Form : | Lyophilized powder |
AA Sequence : | MAIFARRIGLNQHSAYGSRQRVIVMKNFGKKALIKQQSPKRVAWTGALAASLIMLPTMFG GNPVLAQKAERESLSYGELIQKVNQEQVKRVELDETEQIAKVYLKGQKPDAPPIQVRLLE QNNELINRLKEKNVDFGEISSANSRAAVGLLINLMWILPLVALMLLFLRRSTNASSQAMN FGKSRARFQMEAKTGVKFDDVAGIEEAKEELQEVVTFLKQPERFTAVGARIPKGVLLVGP PGTGKTLLAKAIAGEAAVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCLIFIDEI DAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRF DRQVIVDAPDLKGRLEILQVHSRNKKVDPSVSLEAIARRTPGFTGADLANLLNEAAILTA RRRKEAITILEIDDAVDRVVAGMEGTPLVDSKSKRLIAYHEVGHGLVGTLLKDHDPVQKV TLIPRGQAQGLTWFTPNEEQGLISRSQLKARITSTLAGRAAEEIVFGKPEVTTGAGDDLQ KVTSMARQMVTKFGMSELGPLSLENQSGEVFLGRDWMNKSDYSEEIAAKIDSQVREIINT CYQTSKELLQTNRVVMERLVDLLTEQETIEGDLFRKIVSESQNPVVDEQLSMVNSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; all4776; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | Q8YMZ8 |
◆ Recombinant Proteins | ||
YARS1-5498H | Recombinant Human YARS1 Protein (Gly2-Ser528), N-His tagged | +Inquiry |
KYAT1-1540H | Recombinant Human KYAT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARF4-1840M | Recombinant Mouse ARF4 Protein | +Inquiry |
GPLD1-2980H | Recombinant Human GPLD1 Protein (Met496-Asp840), N-His tagged | +Inquiry |
RFL9001AF | Recombinant Full Length Acanthamoeba Castellanii Atp Synthase Subunit A(Atp6) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
HP-127H | Native Human Hemoglobin protein | +Inquiry |
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
Collagen Type I-12P | Native Porcine Collagen Type I Protein | +Inquiry |
GlycoProtein G-11H | Native HSV-2 GlycoProtein G | +Inquiry |
TG-121B | Native Bovine TG | +Inquiry |
◆ Cell & Tissue Lysates | ||
Cerebellar Peduncles-63H | Human Cerebellar Peduncles Lysate | +Inquiry |
GDPGP1-1012HCL | Recombinant Human GDPGP1 cell lysate | +Inquiry |
DDA1-219HCL | Recombinant Human DDA1 lysate | +Inquiry |
PARD3-1283HCL | Recombinant Human PARD3 cell lysate | +Inquiry |
HA-2357HCL | Recombinant H5N3 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket