Recombinant Full Length Nocardia Farcinica Upf0353 Protein Nfa_34780(Nfa_34780) Protein, His-Tagged
Cat.No. : | RFL14995NF |
Product Overview : | Recombinant Full Length Nocardia farcinica UPF0353 protein NFA_34780(NFA_34780) Protein (Q5YU15) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nocardia farcinica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MSISHFTALIWLGFLAVVALIALGYVLVQRSRHRQMLRFSNMEVLEKVAPSRPSPLRHAP IALMLVGLVFLTIAAAGPTSVQKVPRNRATVVLVMDVSLSMEATDVPPSRLEVAQQAGKE FVDGLTQGINLGFVTFAGTASVMQSPTTNREAVKAAIDNIKLAERTATGEGILTALQSIE TLATVLGGAETPPPARIVLMSDGKQTVPDDKDVDNPRHAFTAARLAKSKGIPVSTISFGT EWGSVEIPDQDGQGGSQRVKVPVDNESLREIAKLSGGEFYTASSLEELTAVYDTLEEQIG YETTRGDASRPWLLLGMLVVAAGIVTGLLYRQRLP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NFA_34780 |
Synonyms | NFA_34780; UPF0353 protein NFA_34780 |
UniProt ID | Q5YU15 |
◆ Recombinant Proteins | ||
JPH2-5517Z | Recombinant Zebrafish JPH2 | +Inquiry |
CCBP2-1280M | Recombinant Mouse CCBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BTBD2-1661HF | Recombinant Full Length Human BTBD2 Protein, GST-tagged | +Inquiry |
CRYBA1-1269R | Recombinant Rat CRYBA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25978PF | Recombinant Full Length Porphyromonas Gingivalis Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
SNCA-27339TH | Native Human SNCA | +Inquiry |
Elastase-01H | Active Native Human Sputum Leucocyte Elastase | +Inquiry |
IBVV0400-231I | Native Influenza (B/Victoria/504/00) IBVV0400 protein | +Inquiry |
Proteasome 19S-39H | Native Human Proteasome 19S Protein, Tag Free | +Inquiry |
HP-8153H | Native Human Serum Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO7-608HCL | Recombinant Human FBXO7 cell lysate | +Inquiry |
RCL1-534HCL | Recombinant Human RCL1 lysate | +Inquiry |
SRSF11-1909HCL | Recombinant Human SFRS11 293 Cell Lysate | +Inquiry |
ALPI-1596HCL | Recombinant Human ALPI cell lysate | +Inquiry |
FKBP1B-6209HCL | Recombinant Human FKBP1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NFA_34780 Products
Required fields are marked with *
My Review for All NFA_34780 Products
Required fields are marked with *
0
Inquiry Basket