Recombinant Full Length Nitrosococcus Oceani Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL5893NF |
Product Overview : | Recombinant Full Length Nitrosococcus oceani ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (Q3JEE4) (1-639aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nitrosococcus oceani |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-639) |
Form : | Lyophilized powder |
AA Sequence : | MDNEKQASPPPAAPPLNWRYLLWIILLGIFLISWLGNAGRQAGDEITYTEFKQALHQGKI AKVTLEGQHISGTYHEAGGNIQPEGKDSKGFSTTRPPFDDPELMKLLEQKGVVVQAKSEE PSLWMQAIIGILPWFLILGLIFYVSYRMQQRMMGGGRGGPFGFGKAPVKRFREGSIGVTF EDVAGVENAKRDLREIVDYLKEPGQFKAVGAKIPKGILLVGRPGTGKTLLARAVAGEAGV PFYSISGSDFIEMFVGVGAARVRDMFKAAKEEAPSILFIDEIDSVGRARGTGLGGGHDER EQTLNQILGEMDGFAAHENVVVLAATNRPDVLDPALLRPGRFDRKVVLDLPDKKARQRVL EVHTKNVPLAADVDLERVARRTVGFSGADLANLVNEAALLTGRERKKEVDMDMFNLARDK IVLGAKRETILGEEEKKLVAYHESGHALTAWLLPEADPLHQVSIIPRGMALGVTEQAPEE ERHSLSRAYLLDRLGVMLGGRISEKITFGDVTSGAESDLKQATQLARRMVCQWGMSDKIG AAAFSRSEEHVFLGRELSQPRDFSEQTAQIIDDEIRRILSEVERKTENLLQENRAKLDAL AKALIEAETLNLVEVEKIFKNVKELPQEGHNEAVATGAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; Noc_0272; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | Q3JEE4 |
◆ Recombinant Proteins | ||
N-4304M | Recombinant Measles virus N protein, His-tagged | +Inquiry |
CARM1-451H | Recombinant Human CARM1 | +Inquiry |
FCF1-3986H | Recombinant Human FCF1 Protein, GST-tagged | +Inquiry |
ELOVL7-5153M | Recombinant Mouse ELOVL7 Protein | +Inquiry |
AFUA-647A | Recombinant Aspergillus fumigatus(strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) AFUA protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1806L | Active Native Lycopersicon Esculentum Lectin Protein | +Inquiry |
Lectin-1810M | Active Native Maclura Pomifera Lectin Protein, Biotinylated | +Inquiry |
Lectin-1813P | Active Native Peanut Lectin Protein, Biotinylated | +Inquiry |
ATF-177D | Native Dog Apotransferrin | +Inquiry |
CAPN2-121B | Native Bovine CAPN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
THOC4-1093HCL | Recombinant Human THOC4 293 Cell Lysate | +Inquiry |
TRHR-799HCL | Recombinant Human TRHR 293 Cell Lysate | +Inquiry |
CFL2-7554HCL | Recombinant Human CFL2 293 Cell Lysate | +Inquiry |
CD14-1469RCL | Recombinant Rat CD14 cell lysate | +Inquiry |
TNFAIP8L2-894HCL | Recombinant Human TNFAIP8L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket