Recombinant Full Length Nicotiana Tomentosiformis Photosystem Ii Reaction Center Protein H(Psbh) Protein, His-Tagged
Cat.No. : | RFL34203NF |
Product Overview : | Recombinant Full Length Nicotiana tomentosiformis Photosystem II reaction center protein H(psbH) Protein (Q33C03) (2-73aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nicotiana tomentosiformis (Tobacco) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-73) |
Form : | Lyophilized powder |
AA Sequence : | ATQTVENSSRSGPRRTAVGDLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIY NSSVLLDGISMN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbH |
Synonyms | psbH; Photosystem II reaction center protein H; PSII-H; Photosystem II 10 kDa phosphoprotein |
UniProt ID | Q33C03 |
◆ Recombinant Proteins | ||
HNRNPAB-59H | Recombinant Human HNRNPAB protein, His-tagged | +Inquiry |
VAMP5-6150R | Recombinant Rat VAMP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADIPOQ-19H | Recombinant Human ACRP30 headless, FLAG-tagged | +Inquiry |
OR4M1-3210R | Recombinant Rhesus monkey OR4M1 Protein, His-tagged | +Inquiry |
SLC52A1-5212H | Recombinant Human SLC52A1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SLC40A1-5335H | Native Human Solute Carrier Family 40 (iron-regulated transporter), Member 1 | +Inquiry |
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
IgG-019R | Native Rat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Lectin-1842S | Active Native Solanum Tuberosum Lectin Protein, Biotinylated | +Inquiry |
LDH2-220H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADSSL1-8993HCL | Recombinant Human ADSSL1 293 Cell Lysate | +Inquiry |
LCE3E-4805HCL | Recombinant Human LCE3E 293 Cell Lysate | +Inquiry |
NLK-409HCL | Recombinant Human NLK cell lysate | +Inquiry |
MLX-4287HCL | Recombinant Human MLX 293 Cell Lysate | +Inquiry |
GJC1-294HCL | Recombinant Human GJC1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbH Products
Required fields are marked with *
My Review for All psbH Products
Required fields are marked with *
0
Inquiry Basket