Recombinant Full Length Nicotiana Tabacum Photosystem Ii Reaction Center Protein Z(Psbz) Protein, His-Tagged
Cat.No. : | RFL8741NF |
Product Overview : | Recombinant Full Length Nicotiana tabacum Photosystem II reaction center protein Z(psbZ) Protein (P09974) (1-62aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nicotiana tabacum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-62) |
Form : | Lyophilized powder |
AA Sequence : | MTLAFQLAVFALIATSLILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSL IS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbZ |
Synonyms | psbZ; ycf9; Photosystem II reaction center protein Z; PSII-Z |
UniProt ID | P09974 |
◆ Recombinant Proteins | ||
LYCAT-12463Z | Recombinant Zebrafish LYCAT | +Inquiry |
RPL9-627C | Recombinant Cynomolgus Monkey RPL9 Protein, His (Fc)-Avi-tagged | +Inquiry |
HA-1175I | Recombinant human influenza B virus Hemagglutinin protein, His tagged | +Inquiry |
KAT2A-1392H | Active Recombinant Human KAT2A, GST-tagged | +Inquiry |
ST3GAL1-16062M | Recombinant Mouse ST3GAL1 Protein | +Inquiry |
◆ Native Proteins | ||
AC-63B | Native Bovine Activated Protein C | +Inquiry |
C1q-01M | Native Monkey C1q Protein | +Inquiry |
RPE-426 | Native RPE | +Inquiry |
IgM-255H | Native Human Rheumatoid Factor IgM | +Inquiry |
INS-5435B | Native Bovine Insulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRRX1-2807HCL | Recombinant Human PRRX1 293 Cell Lysate | +Inquiry |
ADPRH-9003HCL | Recombinant Human ADPRH 293 Cell Lysate | +Inquiry |
ZNF529-57HCL | Recombinant Human ZNF529 293 Cell Lysate | +Inquiry |
PFN4-3265HCL | Recombinant Human PFN4 293 Cell Lysate | +Inquiry |
EFEMP1-6705HCL | Recombinant Human EFEMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbZ Products
Required fields are marked with *
My Review for All psbZ Products
Required fields are marked with *
0
Inquiry Basket