Recombinant Full Length Nicotiana Tabacum Atp Synthase Subunit 9, Mitochondrial(Atp9) Protein, His-Tagged
Cat.No. : | RFL9282NF |
Product Overview : | Recombinant Full Length Nicotiana tabacum ATP synthase subunit 9, mitochondrial(ATP9) Protein (P60116) (1-74aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nicotiana tabacum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-74) |
Form : | Lyophilized powder |
AA Sequence : | MLEGAKLMGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIA LFALMMAFLISFVF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATP9 |
Synonyms | ATP9; ATP synthase subunit 9, mitochondrial; Lipid-binding protein |
UniProt ID | P60116 |
◆ Native Proteins | ||
Tf-264R | Native Rat Transferrin | +Inquiry |
slo-01S | Active Native Streptococcus pyogenes Streptolysin O protein | +Inquiry |
Ferritin-025B | Native Bovine Ferritin Protein, apo-form | +Inquiry |
MLC-240H | Native Human Myosin Light Chain | +Inquiry |
APOC2-27331TH | Native Human APOC2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP33-461HCL | Recombinant Human USP33 293 Cell Lysate | +Inquiry |
FCGR2B-1994CCL | Recombinant Cynomolgus FCGR2B cell lysate | +Inquiry |
RUFY4-1551HCL | Recombinant Human RUFY4 cell lysate | +Inquiry |
MCPH1-4412HCL | Recombinant Human MCPH1 293 Cell Lysate | +Inquiry |
ZCCHC12-204HCL | Recombinant Human ZCCHC12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP9 Products
Required fields are marked with *
My Review for All ATP9 Products
Required fields are marked with *
0
Inquiry Basket