Recombinant Full Length Nephroselmis Olivacea Photosystem Q(B) Protein(Psba) Protein, His-Tagged
Cat.No. : | RFL9600NF |
Product Overview : | Recombinant Full Length Nephroselmis olivacea Photosystem Q(B) protein(psbA) Protein (Q9TL35) (2-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nephroselmis olivacea (Green alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-344) |
Form : | Lyophilized powder |
AA Sequence : | TAILERRESTSVWARFCDWVTSTENRLYIGWFGVLMIPLLLTATSVFIIGFIAAPPVDID GIREPVSGSLLFGNNIISGAIIPSSAAIGIHFYPIWEAASIDEWLYNGGCYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVCIWFTALGVSTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbA |
Synonyms | psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein |
UniProt ID | Q9TL35 |
◆ Recombinant Proteins | ||
PI4KB-4906H | Recombinant Human PI4KB Protein (Met1-Met801), C-His tagged | +Inquiry |
PDGFB-4406C | Recombinant Chicken PDGFB Protein | +Inquiry |
MRPL44-5704M | Recombinant Mouse MRPL44 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYCT1-3553H | Recombinant Human MYCT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTPN11-519H | Active Recombinant Human PTPN11 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1724C | Native Canavalia ensiformis Lectin | +Inquiry |
LDH-35C | Active Native Chicken Lactate dehydrogenase | +Inquiry |
KLC-212H | Native Human Kappa Light Chain | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
Pertussis-37 | Native Pertussis Toxin Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Breast-55H | Human Breast Lysate | +Inquiry |
CYP4V2-440HCL | Recombinant Human CYP4V2 cell lysate | +Inquiry |
C4orf33-8028HCL | Recombinant Human C4orf33 293 Cell Lysate | +Inquiry |
JKAMP-5103HCL | Recombinant Human JKAMP 293 Cell Lysate | +Inquiry |
Bone-13H | Human Bone Tumor Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbA Products
Required fields are marked with *
My Review for All psbA Products
Required fields are marked with *
0
Inquiry Basket