Recombinant Full Length Nephroselmis Olivacea Cytochrome B6-F Complex Subunit 4(Petd) Protein, His-Tagged
Cat.No. : | RFL18470NF |
Product Overview : | Recombinant Full Length Nephroselmis olivacea Cytochrome b6-f complex subunit 4(petD) Protein (Q9TL32) (1-160aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nephroselmis olivacea (Green alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-160) |
Form : | Lyophilized powder |
AA Sequence : | MSVTKKPDLTDPVLRAKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTLSCITGLAVLDPA AIGEPANPFATPLEILPEWYFFPVFQLLRTVPNKLLGVLLMAAVPAGLLTVPFIESINKF QNPFRRPVATTVFLIGTVVAIWLGIGATLPIDISLTLGLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petD |
Synonyms | petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide |
UniProt ID | Q9TL32 |
◆ Recombinant Proteins | ||
H2-AA-4038M | Recombinant Mouse H2-AA Protein, His (Fc)-Avi-tagged | +Inquiry |
GM4980-6805M | Recombinant Mouse GM4980 Protein | +Inquiry |
ACSS1-263H | Recombinant Human ACSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Abra-1480M | Recombinant Mouse Abra Protein, Myc/DDK-tagged | +Inquiry |
ITGB6-253H | Recombinant Human ITGB6 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Apotransferrin-39H | Native Human Apotransferrin | +Inquiry |
MOMP-02C | Native C. trachomatis MOMP Antigen | +Inquiry |
Prostate-016H | Human Prostate Lysate, Total Protein | +Inquiry |
pepsin -173P | Native Pig pepsin | +Inquiry |
IgG1 Fc-08H | Native Human Immunoglobulin G1 (IgG1) FC Fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
PINK1-3929HCL | Recombinant Human PINK1 Cell Lysate | +Inquiry |
TCF4-1178HCL | Recombinant Human TCF4 293 Cell Lysate | +Inquiry |
CX3CR1-7173HCL | Recombinant Human CX3CR1 293 Cell Lysate | +Inquiry |
FAM57B-6364HCL | Recombinant Human FAM57B 293 Cell Lysate | +Inquiry |
MES-SA-Dx5-1078H | MES-SA/Dx5 (human uterine sarcoma, MDR variant) nuclear extract lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All petD Products
Required fields are marked with *
My Review for All petD Products
Required fields are marked with *
0
Inquiry Basket