Recombinant Full Length Neosartorya Fumigata Rhomboid Protein 2(Rbd2) Protein, His-Tagged
Cat.No. : | RFL1818NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata Rhomboid protein 2(rbd2) Protein (Q4WLP9) (1-272aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-272) |
Form : | Lyophilized powder |
AA Sequence : | MAIPAALPPLPFNPTRVRSYMLRLPLFTRLVLLVILAFWLLELQTIWSVVQWGSLTPNEI GIGSMYRLNTYPFIHVGFFHAFVNLLALTPLLERFEAEHGTLTAVALFIGPLSTFPAGIY ILVEKFILRSNTAVVGASVWIFLLLGSEAIKTFKSNPYFSLGTTKIPTWTSPLFACALVS IFVPNTSFLGHLSAIIIGYLLGLGYLKVFVPPEKILRWIEGKLNLLGRLPHYVSVDQKTY GRYGVLPTATAAVGGERPTPLSYLGTNQRLGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rbd2 |
Synonyms | rbd2; AFUA_6G12750; Rhomboid protein 2 |
UniProt ID | Q4WLP9 |
◆ Native Proteins | ||
G6PD-26 | Active Native Glucose-6-phosphate dehydrogenase | +Inquiry |
Fixa-280B | Active Native Bovine Factor IXa - DEGR | +Inquiry |
C4A-158H | Native Human C4A protein | +Inquiry |
IgA-7431M | Native Mouse Immunoglobulin A | +Inquiry |
Hyaluronidase-39O | Active Native Ovine Hyaluronidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
APEX1-8796HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
KRTAP23-1-4843HCL | Recombinant Human KRTAP23 293 Cell Lysate | +Inquiry |
IDH3A-5305HCL | Recombinant Human IDH3A 293 Cell Lysate | +Inquiry |
NA-002H1N1CL | Recombinant H1N1 NA cell lysate | +Inquiry |
SNRNP27-1624HCL | Recombinant Human SNRNP27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All rbd2 Products
Required fields are marked with *
My Review for All rbd2 Products
Required fields are marked with *
0
Inquiry Basket