Recombinant Full Length Neosartorya Fumigata Palmitoyltransferase Pfa4(Pfa4) Protein, His-Tagged
Cat.No. : | RFL350NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata Palmitoyltransferase pfa4(pfa4) Protein (Q4WC37) (1-428aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-428) |
Form : | Lyophilized powder |
AA Sequence : | MLCRSFNISQLAIPFVSVLISFLAYTSQLFFYYFEEAPLRSEEFWRLNIFAVCIWVCYYR ACTVDPGRIPKDWTPPNLKQLEKDCAGGRQRWCRRCEAFKPPRAHHCKTCQRCIPKMDHH CPWTSNCVSHFTYPHFMRFLFYAVVGMGYLETLLFERASIVWASRHLPSYLGPGLGQLVH LFILLVVNSLTWLALFILLLRSIWSLALNTTTIESWEIERHETLLRRARHFGGYLSGPGG IQIRIKKQEFPYDIGIWSNIRAGMGGSANVLSWFWPFAATPDRSTGLEFEVNGFEDPNLS WPPPDPDRIPLPAKREDMSAAIAAADASYHRALQARNIQRSNDASHSGGHPIQRRKRFHD RFNENKAKERLSESESDFSDDEEVQDGEEGWKNSEGDRLRDFGVDEEAEFYDEEDIPLGI LMQRRRQQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pfa4 |
Synonyms | pfa4; AFUA_8G05830; Palmitoyltransferase pfa4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4 |
UniProt ID | Q4WC37 |
◆ Native Proteins | ||
ALPL-5324H | Active Native Human Alkaline Phosphatase | +Inquiry |
Lysozyme-073H | Native Human Lysozyme Protein | +Inquiry |
S100A1B-9H | Native Human S100A1B | +Inquiry |
PGC-8318H | Native Human PGC | +Inquiry |
Lectin-1807M | Active Native Maackia Amurensis Lectin I Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDOR1-3933HCL | Recombinant Human NDOR1 293 Cell Lysate | +Inquiry |
CD6-958RCL | Recombinant Rat CD6 cell lysate | +Inquiry |
F2R-2116HCL | Recombinant Human F2R cell lysate | +Inquiry |
LRRC29-4638HCL | Recombinant Human LRRC29 293 Cell Lysate | +Inquiry |
DNMBP-501HCL | Recombinant Human DNMBP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pfa4 Products
Required fields are marked with *
My Review for All pfa4 Products
Required fields are marked with *
0
Inquiry Basket