Recombinant Full Length Neosartorya Fumigata Mitochondrial Thiamine Pyrophosphate Carrier 1(Tpc1) Protein, His-Tagged
Cat.No. : | RFL1437NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata Mitochondrial thiamine pyrophosphate carrier 1(tpc1) Protein (Q4X022) (1-317aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-317) |
Form : | Lyophilized powder |
AA Sequence : | MSAGGEHLKDEGTRRQVVLSGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPASHHDVVG PIYKGTLSTMRTIIKQEGITGLWKGNIPAELMYVCYGALQFTAYRTTTQILAQLDPHRLP PALESFVSGAVAGGLATASTYPLDLLRTRFAAQGTERIYTSLLASVRDIARSEGPAGFFR GCSAAVGQIVPYMGLFFATYESLRPVLSGLENMPFGSGDAAAGVIASVLAKSGVFPLDLV RKRLQVQGPTRTLYVHRNIPEYRGVFSTIAMIVRTQGVRGLYRGLTVSLIKAAPASAITM WTYERSLKLLRDFRVAE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tpc1 |
Synonyms | tpc1; AFUA_2G14980; Mitochondrial thiamine pyrophosphate carrier 1 |
UniProt ID | Q4X022 |
◆ Recombinant Proteins | ||
PHES-0666B | Recombinant Bacillus subtilis PHES protein, His-tagged | +Inquiry |
DIMT1-1213H | Recombinant Human DIMT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ENO1-7454H | Recombinant Human ENO1 protein, His-tagged | +Inquiry |
GMFB-28147TH | Recombinant Human GMFB, His-tagged | +Inquiry |
RQCD1-12780Z | Recombinant Zebrafish RQCD1 | +Inquiry |
◆ Native Proteins | ||
Lectin-1831R | Active Native Ricinus Communis Agglutinin I Protein, Biotinylated | +Inquiry |
ALPP-8005H | Native Human Placental Alkaline Phosphatase | +Inquiry |
FABP-177R | Native Rabbit Fatty acid Binding Protein | +Inquiry |
Lectin-1775E | Active Native Erythrina Cristagalli Lectin Protein | +Inquiry |
FABP-178R | Native Rat Fatty acid Binding Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNPC3-2261HCL | Recombinant Human RNPC3 293 Cell Lysate | +Inquiry |
TOM1-1807HCL | Recombinant Human TOM1 cell lysate | +Inquiry |
PRDX4-2880HCL | Recombinant Human PRDX4 293 Cell Lysate | +Inquiry |
COL9A1-796HCL | Recombinant Human COL9A1 cell lysate | +Inquiry |
CCDC76-299HCL | Recombinant Human CCDC76 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All tpc1 Products
Required fields are marked with *
My Review for All tpc1 Products
Required fields are marked with *
0
Inquiry Basket