Recombinant Full Length Neosartorya Fumigata Mitochondrial Import Inner Membrane Translocase Subunit Tim21(Tim21) Protein, His-Tagged
Cat.No. : | RFL30362NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata Mitochondrial import inner membrane translocase subunit tim21(tim21) Protein (Q4X1I8) (36-237aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (36-237) |
Form : | Lyophilized powder |
AA Sequence : | ATQSDLGGGSGSKATPRRRNVTVLSDDGRYEWGELSGREKVARATQQSLNFLVIVAGAVL TGGVFYLLYTEVFSPNSRTWQFEKAVQRIKDDPRCTDLLGDRREIKAYGESTGSRWERNR PIATSMFKDRQGREHMKMHFHVEGPLNSGIVIVHMMKPLDKDEWEYLLLALDVKGHSRVI LEQAQEKPGVAKALKIFGIQWR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tim21 |
Synonyms | tim21; AFUA_2G09820; Mitochondrial import inner membrane translocase subunit tim21 |
UniProt ID | Q4X1I8 |
◆ Recombinant Proteins | ||
Abcb9-8132M | Recombinant Mouse Abcb9 protein, His & T7-tagged | +Inquiry |
TESK1-6016R | Recombinant Rat TESK1 Protein | +Inquiry |
NTRK3-160HAF647 | Active Recombinant Human NTRK3 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
PRL7D1-13404M | Recombinant Mouse PRL7D1 Protein | +Inquiry |
RFL15849MF | Recombinant Full Length Methanocaldococcus Jannaschii Probable Atpase Proteolipid Chain(Mj0221) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
ATF-180M | Native Mouse Apotransferrin | +Inquiry |
Fva-285B | Active Native Bovine Factor Va | +Inquiry |
BOD-38 | Active Native Bilirubin oxidase | +Inquiry |
F12-5397H | Active Native Human Coagulation Factor XII (Hageman factor) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD97-2475HCL | Recombinant Human CD97 cell lysate | +Inquiry |
7860-028WCY | Human Kidney Renal Cell Carcinoma 7860 Whole Cell Lysate | +Inquiry |
HA-2663HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
Stomach-479C | Cynomolgus monkey Stomach Lysate | +Inquiry |
Kidney-072MCL | Adult Mouse Kidney Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tim21 Products
Required fields are marked with *
My Review for All tim21 Products
Required fields are marked with *
0
Inquiry Basket