Recombinant Full Length Neosartorya Fumigata Gpi Mannosyltransferase 4(Smp3) Protein, His-Tagged
Cat.No. : | RFL2354NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata GPI mannosyltransferase 4(smp3) Protein (Q4WTT7) (1-547aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-547) |
Form : | Lyophilized powder |
AA Sequence : | MWRRTYLLLLLVRVYFALSPSYLHPDENFQGPELFAGRTLSYPSKLPWEFTSENPIRSVF PLWPVYSLPMGLLKWFYVELEIGNPSPEVAYYSLRAVMFLLSFVLEDWAIYELVPLPRHR RAAVVLVASSYVTWTYQTHTFSNSLETLLVTWGLVLIRRIAGQKRRSSVFSCVVLALITV AGVFNRITFPAFLLIPGLQLLPHFWRRPTSLFVFVLWGLFFSCTAIIIDTRFYRPSASVL DALRSPIITPLNNLLYNTKTSNLALHGLHPHYQHFLINLPQLLGPAFVAMILSLWNRPAI PSWLKTTQAVSALSGTAMLSVFPHQEPRFLIPCVPLLLSCFRLRKSRLFIVAWVIFNVAL GFLMGVYHQGGVVPVQLAIPNIISANTLKSNKSLENQPRVSATVLWWKTYSPPSWLLGNN TNFPLDIDTRDLMGIPGAEMAQELEQLVPPCSSHSGTHMDDASAGSGRADRTNFVLVVAP RSATYLDQYTTAAAGSSGLELQELYSYPQHINMDDLDVGTDGLLATLKRVFGRRGLNVWL ARRAGCD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | smp3 |
Synonyms | smp3; AFUA_5G06050; GPI mannosyltransferase 4; GPI mannosyltransferase IV; GPI-MT-IV |
UniProt ID | Q4WTT7 |
◆ Recombinant Proteins | ||
AGRG3-1047HFL | Recombinant Human AGRG3 protein, His&Flag-tagged | +Inquiry |
CLDN6-2060HF | Recombinant Full Length Human CLDN6 Protein, GST-tagged | +Inquiry |
APOD-725R | Recombinant Rat APOD Protein | +Inquiry |
RFL25895PF | Recombinant Full Length Nad(P)H-Quinone Oxidoreductase Subunit 4L, Organellar Chromatophore Protein, His-Tagged | +Inquiry |
FAM86C1-3811H | Recombinant Human FAM86C1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Plasmin-250H | Active Native Human Plasmin | +Inquiry |
BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
LTF-4771H | Native Human Lactotransferrin | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
SERPINE1-5514R | Native Rabbit Serpin Peptidase Inhibitor, Clade E (nexin, plasminogen activator inhibitor type 1), Member 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Kidney-270R | Rhesus monkey Kidney Membrane Lysate | +Inquiry |
DENND5A-1456HCL | Recombinant Human DENND5A cell lysate | +Inquiry |
CCDC96-165HCL | Recombinant Human CCDC96 lysate | +Inquiry |
STX5-1374HCL | Recombinant Human STX5 293 Cell Lysate | +Inquiry |
NEUROG2-3864HCL | Recombinant Human NEUROG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All smp3 Products
Required fields are marked with *
My Review for All smp3 Products
Required fields are marked with *
0
Inquiry Basket