Recombinant Full Length Neoniphon Aurolineatus Rhodopsin(Rho) Protein, His-Tagged
Cat.No. : | RFL29634NF |
Product Overview : | Recombinant Full Length Neoniphon aurolineatus Rhodopsin(rho) Protein (P79809) (1-347aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neoniphon aurolineatus (Yellowstriped squirrelfish) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-347) |
Form : | Lyophilized powder |
AA Sequence : | TEGPDFYIPMVNTSGLVRSPYEYPQYYLVNPAAFAFLGAYMFFLIIIGFPVNFLTLYVTL EHKKLRTPLNYILLNLAVSDLFMVIGGFTTTMYSSMHGYFVLGRLGCNIEGFFATLGGMI SLWSLAVLAIERWVVVCKPISNFRFGENHAIMGVSMTWLLALSCTVPPLVGWSRYIPEGM QCACGIDYYTRAEGYNNESFVIYMFTCHFSVPLFIIFFCYGRLLCAVKEAAAAQQESETT QRAEREVTRMVVIMVIGFLVCWLPYASVAWFIFTHQGSEFGPLFMAIPSFFAKSSSIYNP VIYICMNKQFRQCMITTLFCGKNPFEGEEEGSSTKTEASSASSVSPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rho |
Synonyms | rho; Rhodopsin; Fragment |
UniProt ID | P79809 |
◆ Recombinant Proteins | ||
FMR1NB-4680H | Recombinant Human FMR1NB protein, His&Myc-tagged | +Inquiry |
SLC25A48-15335M | Recombinant Mouse SLC25A48 Protein | +Inquiry |
APOBEC3H-366R | Recombinant Rhesus monkey APOBEC3H Protein, His-tagged | +Inquiry |
RFL1224CF | Recombinant Full Length Clostridium Perfringens Cobalamin Synthase(Cobs) Protein, His-Tagged | +Inquiry |
IL34-2141H | Recombinant Human IL34 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG2-229H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
AMY2B-1858H | Native Human Amylase, Alpha 2B (pancreatic) | +Inquiry |
CASQ2-30C | Native Canine CASQ2 | +Inquiry |
Chymotrypsin-163B | Active Native Bovine Chymotrypsin | +Inquiry |
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF152-2290HCL | Recombinant Human RNF152 293 Cell Lysate | +Inquiry |
Kidney-99M | Mouse Kidney Tissue Lysate | +Inquiry |
Cecum-62C | Cynomolgus monkey Cecum Lysate | +Inquiry |
GSDMD-5725HCL | Recombinant Human GSDMD 293 Cell Lysate | +Inquiry |
TXNDC5-622HCL | Recombinant Human TXNDC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All rho Products
Required fields are marked with *
My Review for All rho Products
Required fields are marked with *
0
Inquiry Basket