Recombinant Full Length Neisseria Meningitidis Serogroup C Upf0761 Membrane Protein Nmcc_0461 (Nmcc_0461) Protein, His-Tagged
Cat.No. : | RFL32531NF |
Product Overview : | Recombinant Full Length Neisseria meningitidis serogroup C UPF0761 membrane protein NMCC_0461 (NMCC_0461) Protein (A9M1Y8) (1-408aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neisseria meningitidis serogroup C |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-408) |
Form : | Lyophilized powder |
AA Sequence : | MTFLQRLQGLADNKICAFAWFVVRRFDEERVPQAAASMTFTTLLALVPVLTVMVAVASIF PVFDRWSDSFVSFVNQTIVPQGADMVFDYINAFREQANRLTAIGSVMLVVTSLMLIRTID NTFNRIWRVNSQRPWMMQFLVYWALLTFGPLSLGVGISFMVGSVQDAALASGAPQWSGAL RTAATLTFMTLLLWGLYRFVPNRFVPARQAFVGALATAFCLETARSLFTWYMGNFDGYRS IYGAFAAVPFFLLWLNLLWTLVLGGAVLTSSLSYWQGEAFRRGFDSRGRFDDVLKILLLL DAAQKEGKALPVQEFRRHINMGYDELGELLEKLARHGYIYSGRQGWVLKTGADSIELNEL FKLFVYRPLPVERDHVNQAVDAVMMPCLQTLNMTLAEFDAQAKKQQQS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NMCC_0461 |
Synonyms | NMCC_0461; UPF0761 membrane protein NMCC_0461 |
UniProt ID | A9M1Y8 |
◆ Recombinant Proteins | ||
DVL2-4900M | Recombinant Mouse DVL2 Protein | +Inquiry |
C14ORF129-29411TH | Recombinant Human C14ORF129, His-tagged | +Inquiry |
PRSS23-3456R | Recombinant Rhesus Macaque PRSS23 Protein, His (Fc)-Avi-tagged | +Inquiry |
SMO-5623R | Recombinant Rat SMO Protein | +Inquiry |
RFL10258BF | Recombinant Full Length Bacillus Amyloliquefaciens Upf0295 Protein Rbam_008830 (Rbam_008830) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Amylase-63P | Active Native Pig Amylase, alpha | +Inquiry |
Plasmin-251H | Active Native Human Plasmin | +Inquiry |
Hyaluronidase-35O | Active Native Ovine Hyaluronidase, 300U/mg | +Inquiry |
FDP-X-51H | Native Human Fibrinogen Degrading Product-X | +Inquiry |
Cp-048R | Native Rat Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
BPNT1-8415HCL | Recombinant Human BPNT1 293 Cell Lysate | +Inquiry |
MAPK9-4485HCL | Recombinant Human MAPK9 293 Cell Lysate | +Inquiry |
STOM-1393HCL | Recombinant Human STOM 293 Cell Lysate | +Inquiry |
KRT35-962HCL | Recombinant Human KRT35 cell lysate | +Inquiry |
CNTN2-1518MCL | Recombinant Mouse CNTN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NMCC_0461 Products
Required fields are marked with *
My Review for All NMCC_0461 Products
Required fields are marked with *
0
Inquiry Basket