Recombinant Full Length Na(+)-Translocating Nadh-Quinone Reductase Subunit D(Nqrd) Protein, His-Tagged
Cat.No. : | RFL35054VF |
Product Overview : | Recombinant Full Length Na(+)-translocating NADH-quinone reductase subunit D(nqrD) Protein (Q57095) (2-210aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio alginolyticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-210) |
Form : | Lyophilized powder |
AA Sequence : | SSAQNVKKSILAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVTFVTALSNFSVSL IRNHIPNSVRIIVQMAIIASLVIVVDQVLKAYLYDISKQLSVFVGLIITNCIVMGRAEAF AMKSAPVPSLIDGIGNGLGYGFVLITVGFFRELFGSGKLFGLEVLPLVSNGGWYQPNGLM LLAPSAFFLIGFLIWVIRILKPEQVEAKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nqrD |
Synonyms | nqrD; nqr4; Na(+-translocating NADH-quinone reductase subunit D; Na(+-NQR subunit D; Na(+-translocating NQR subunit D; NQR complex subunit D; NQR-1 subunit D |
UniProt ID | Q57095 |
◆ Recombinant Proteins | ||
HIST1H4D-4210M | Recombinant Mouse HIST1H4D Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINI1-5347R | Recombinant Rat SERPINI1 Protein | +Inquiry |
Sil1-5880M | Recombinant Mouse Sil1 Protein, Myc/DDK-tagged | +Inquiry |
PPP1R1A-4279R | Recombinant Rat PPP1R1A Protein, His (Fc)-Avi-tagged | +Inquiry |
VP1-04A | Recombinant AAV2 VP1 Protein, Strep/SUMO/His-tagged | +Inquiry |
◆ Native Proteins | ||
Fxa-66R | Native Rat Factor Ixa | +Inquiry |
MAP-30 | Native Mytilus edulis MAP Protein | +Inquiry |
CLU-19H | Native Human Clusterin Protein | +Inquiry |
FBa-12H | Native Human Factor Ba protein | +Inquiry |
ATF-180M | Native Mouse Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSN2-7244HCL | Recombinant Human CSN2 293 Cell Lysate | +Inquiry |
ENSA-6593HCL | Recombinant Human ENSA 293 Cell Lysate | +Inquiry |
AMDHD2-8884HCL | Recombinant Human AMDHD2 293 Cell Lysate | +Inquiry |
FANCG-6331HCL | Recombinant Human FANCG 293 Cell Lysate | +Inquiry |
TRPC5-742HCL | Recombinant Human TRPC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nqrD Products
Required fields are marked with *
My Review for All nqrD Products
Required fields are marked with *
0
Inquiry Basket