Recombinant Full Length Mystacina Tuberculata Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged
Cat.No. : | RFL17879MF |
Product Overview : | Recombinant Full Length Mystacina tuberculata NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L) Protein (Q58F60) (1-98aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mystacina tuberculata (New Zealand lesser short-tailed bat) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-98) |
Form : | Lyophilized powder |
AA Sequence : | MSLTYMNILVAFVISLTGLLMYRSHMMSSLLCLEGMMLSLFVMVTITILNTHLTLASMMP IILLVFAACEAALGLALLVMVSNTYGVDYVQNLNLLQC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MT-ND4L |
Synonyms | MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L |
UniProt ID | Q58F60 |
◆ Recombinant Proteins | ||
NTSR2-758H | Recombinant Human NTSR2 | +Inquiry |
TBXT-2165H | Recombinant Human TBXT Protein, His (Fc)-Avi-tagged | +Inquiry |
Ccl22-2034M | Recombinant Mouse Ccl22 Protein, Myc/DDK-tagged | +Inquiry |
NDUFAB1-2977R | Recombinant Rhesus monkey NDUFAB1 Protein, His-tagged | +Inquiry |
RBM3-582H | Recombinant Human RNA binding motif (RNP1, RRM) protein 3, His-tagged | +Inquiry |
◆ Native Proteins | ||
PNLIP-8203H | Native Human Pancreatic Lipase | +Inquiry |
CLU-67H | Native Human Clusterin | +Inquiry |
CGA-8162H | Native Human Pregnancy Chorionic Gonadotropin | +Inquiry |
Cytochrome c-023H | Native Human Cytochrome c Protein | +Inquiry |
RPE-425 | Native Red algae RPE | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNXB-876HCL | Recombinant Human TNXB 293 Cell Lysate | +Inquiry |
SSBP1-1465HCL | Recombinant Human SSBP1 293 Cell Lysate | +Inquiry |
GJC1-294HCL | Recombinant Human GJC1 lysate | +Inquiry |
RSPO1-001HCL | Recombinant Human RSPO1 cell lysate | +Inquiry |
SDCCAG8-1576HCL | Recombinant Human SDCCAG8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MT-ND4L Products
Required fields are marked with *
My Review for All MT-ND4L Products
Required fields are marked with *
0
Inquiry Basket