Recombinant Full Length Mycoplasma Pneumoniae Uncharacterized Protein Mg242 Homolog (Mpn_338) Protein, His-Tagged
Cat.No. : | RFL35MF |
Product Overview : | Recombinant Full Length Mycoplasma pneumoniae Uncharacterized protein MG242 homolog (MPN_338) Protein (P75440) (1-632aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-632) |
Form : | Lyophilized powder |
AA Sequence : | MEFNKLQLSHCISFYISDVSEVFFESINQHPSRDFVNNILQKIKSTLSEEELEKLNTIEE VTKDEKILIMLNHVLKKIVSKTGSSSCDLFQIVKHDRFNEPVYIQSVNAFENNLINNEFA ERRYDYLIEINKHSYLRKYVNAIRISFFLDLRAQILSGSFTLDVINKQLEHQNKEELFQA IYLRSLIKHFISNQLYPISLNSFIFGDKNRENKTVENDKLSVLKNNWNQIFFSKYFDFVA KNKEERVVDNNCDELFYATMNTLLIMLIIIEELRVYFNSKEPALILKLLDNKVSLREDPD QNPETDLHELIKFAEKNYLEKEKTSRWHKKRVKSLEELLEEIKQINLETKNESLAYPDEI VELELDNVHNFVSTKQVFRHQLDLQTLHGIVINPERYGIGMWSNHFVDWEEFKDLIEQIT DAENGSDLYGFEKDLDESICQVNKKYLTFISSDSSSFLIIKNDQTKVISNYVWAQLYFET RRWIINDIEYDLYEKGFDKSHFASNIALLESLNFNWLDPFYGLTSIKEIMQKIDSKSNLK TSIAEMVAKFKHEQRISKKDNERVLMIFAYVAAAVVGFINFFSMVFTILTVSDLNAGLTP ANIVVIAIASLLALFLIVIAVLFRFRWKYIKH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPN_338 |
Synonyms | MPN_338; F10_orf632o; MP498; Uncharacterized protein MG242 homolog |
UniProt ID | P75440 |
◆ Recombinant Proteins | ||
INHBB-1546H | Recombinant human Activin B, Active, His-tagged | +Inquiry |
ATG5-828M | Recombinant Mouse ATG5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADCY2-517R | Recombinant Rat ADCY2 Protein | +Inquiry |
MOB3C-409Z | Recombinant Zebrafish MOB3C | +Inquiry |
GPR110-7126M | Recombinant Mouse GPR110 Protein | +Inquiry |
◆ Native Proteins | ||
LAMA-69M | Native Mouse Laminin protein | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
Transglutaminase-88G | Active Native Guinea pig liver Transglutaminase | +Inquiry |
KRT19-382H | Native Human KRT19 | +Inquiry |
SERPINA1-27286TH | Native Human SERPINA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BABAM1-8197HCL | Recombinant Human C19orf62 293 Cell Lysate | +Inquiry |
FLRT2-1944HCL | Recombinant Human FLRT2 cell lysate | +Inquiry |
FDCSP-8021HCL | Recombinant Human C4orf7 293 Cell Lysate | +Inquiry |
FAM71A-6356HCL | Recombinant Human FAM71A 293 Cell Lysate | +Inquiry |
NDUFA4-3919HCL | Recombinant Human NDUFA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPN_338 Products
Required fields are marked with *
My Review for All MPN_338 Products
Required fields are marked with *
0
Inquiry Basket